DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd19B and Foxc1

DIOPT Version :9

Sequence 1:NP_608369.1 Gene:fd19B / 33010 FlyBaseID:FBgn0031086 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_599165.1 Gene:Foxc1 / 364706 RGDID:1589718 Length:553 Species:Rattus norvegicus


Alignment Length:147 Identity:58/147 - (39%)
Similarity:76/147 - (51%) Gaps:18/147 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 KSNAKPAFTYSALIVMAIWSSSEKRLTLSGICKWIADNFPYYRTRKSVWQNSIRHNLSLNPFFVR 118
            |...||.::|.|||.|||.::.:|::||:||.::|.|.||:||..|..||||||||||||..||:
  Rat    74 KDMVKPPYSYIALITMAIQNAPDKKITLNGIYQFIMDRFPFYRDNKQGWQNSIRHNLSLNECFVK 138

  Fly   119 VPRALDDPGRGHYWALDPYAEDLSIGETTGRLRRSNWQQNTGA----------------RPKVTG 167
            |||....||:|.||.|||  :..::.|....|||....:...|                .|:...
  Rat   139 VPRDDKKPGKGSYWTLDP--DSYNMFENGSFLRRRRRFKKKDAVKDKEEKGRLHLQEPPPPQAGR 201

  Fly   168 HPYQRMPYYGHGHGNGP 184
            .|....|....|...||
  Rat   202 QPAPAPPEQAEGSAPGP 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd19BNP_608369.1 FH 58..135 CDD:238016 43/76 (57%)
Foxc1NP_599165.1 FH 78..166 CDD:214627 47/89 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.