| Sequence 1: | NP_608369.1 | Gene: | fd19B / 33010 | FlyBaseID: | FBgn0031086 | Length: | 260 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_004505.2 | Gene: | FOXK2 / 3607 | HGNCID: | 6036 | Length: | 660 | Species: | Homo sapiens |
| Alignment Length: | 196 | Identity: | 68/196 - (34%) |
|---|---|---|---|
| Similarity: | 99/196 - (50%) | Gaps: | 35/196 - (17%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 18 SVDKKEESPISKHNSGSSF--------SSCSSSSSNS-------SSDSMAAKSNAKPAFTYSALI 67
Fly 68 VMAIWSSSEKRLTLSGICKWIADNFPYYRTRKSVWQNSIRHNLSLNPFFVRVPRALDDPGRGHYW 132
Fly 133 ALDPYAEDLSIGETTGRLRRSNWQQNTGARPKVTGHPYQRMPYYGHGHGNGP-------YIKAHS 190
Fly 191 A 191 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| fd19B | NP_608369.1 | FH | 58..135 | CDD:238016 | 41/76 (54%) |
| FOXK2 | NP_004505.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..36 | ||
| FHA | 47..154 | CDD:238017 | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 85..104 | ||||
| Required for interaction with DVL2 and SUDS3. /evidence=ECO:0000269|PubMed:25805136 | 129..171 | ||||
| COG5025 | <180..577 | CDD:227358 | 68/196 (35%) | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 203..260 | 11/56 (20%) | |||
| Forkhead | 257..343 | CDD:365978 | 44/85 (52%) | ||
| DNA-binding, major groove. /evidence=ECO:0000269|PubMed:16624804 | 300..318 | 13/17 (76%) | |||
| DNA-binding, minor groove. /evidence=ECO:0000269|PubMed:16624804 | 328..332 | 1/3 (33%) | |||
| DNA-binding, minor groove. /evidence=ECO:0000269|PubMed:16624804 | 348..353 | 3/14 (21%) | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 359..407 | 6/27 (22%) | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 610..632 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E2759_KOG2294 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D1270467at2759 | |
| OrthoFinder | 1 | 1.000 | - | - | FOG0000010 | |
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 4 | 3.820 | |||||