DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd19B and FOXK2

DIOPT Version :10

Sequence 1:NP_608369.1 Gene:fd19B / 33010 FlyBaseID:FBgn0031086 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_004505.2 Gene:FOXK2 / 3607 HGNCID:6036 Length:660 Species:Homo sapiens


Alignment Length:196 Identity:68/196 - (34%)
Similarity:99/196 - (50%) Gaps:35/196 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 SVDKKEESPISKHNSGSSF--------SSCSSSSSNS-------SSDSMAAKSNAKPAFTYSALI 67
            ::......|.|...:|||.        |..:..:.||       :|...:.|.::||.::|:.||
Human   203 TISAANSCPSSPRGAGSSGYKVGRVMPSDLNLMADNSQPENEKEASGGDSPKDDSKPPYSYAQLI 267

  Fly    68 VMAIWSSSEKRLTLSGICKWIADNFPYYRTRKSVWQNSIRHNLSLNPFFVRVPRALDDPGRGHYW 132
            |.||..:.:|:|||:||...|..|:|||||....||||||||||||.:|::|||:.::||:|.:|
Human   268 VQAITMAPDKQLTLNGIYTHITKNYPYYRTADKGWQNSIRHNLSLNRYFIKVPRSQEEPGKGSFW 332

  Fly   133 ALDPYAEDLSIGETTGRLRRSNWQQNTGARPKVTGHPYQRMPYYGHGHGNGP-------YIKAHS 190
            .:||.:|...| |...|.|          ||:  |.|..|.|.......:.|       .:.|||
Human   333 RIDPASESKLI-EQAFRKR----------RPR--GVPCFRTPLGPLSSRSAPASPNHAGVLSAHS 384

  Fly   191 A 191
            :
Human   385 S 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd19BNP_608369.1 Forkhead 58..140 CDD:459732 43/81 (53%)
FOXK2NP_004505.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..36
FHA_FOXK2 35..157 CDD:438775
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 85..104
Required for interaction with DVL2 and SUDS3. /evidence=ECO:0000269|PubMed:25805136 129..171
COG5025 <180..577 CDD:227358 68/196 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 203..260 11/56 (20%)
FH_FOXK2 256..353 CDD:410829 49/107 (46%)
DNA-binding, major groove. /evidence=ECO:0000269|PubMed:16624804 300..318 13/17 (76%)
DNA-binding, minor groove. /evidence=ECO:0000269|PubMed:16624804 328..332 1/3 (33%)
DNA-binding, minor groove. /evidence=ECO:0000269|PubMed:16624804 348..353 3/14 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 359..407 6/27 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 610..632
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.