DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd19B and foxi1

DIOPT Version :9

Sequence 1:NP_608369.1 Gene:fd19B / 33010 FlyBaseID:FBgn0031086 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_859424.1 Gene:foxi1 / 353313 ZFINID:ZDB-GENE-030505-1 Length:377 Species:Danio rerio


Alignment Length:279 Identity:76/279 - (27%)
Similarity:112/279 - (40%) Gaps:104/279 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 ISKHNSGSSFSSCSSSSSN---------SSSD----SMAAKSN----AKPAFTYSALIVMAIWSS 74
            :|..|.||...|...|:..         .|:|    |::::..    .:|.::|||||.|||.::
Zfish    93 LSSPNGGSYIQSGFGSNQRQFLPPPTGFGSADLGWLSISSQQELFKMVRPPYSYSALIAMAIQNA 157

  Fly    75 SEKRLTLSGICKWIADNFPYYRTRKSVWQNSIRHNLSLNPFFVRVPRALDDPGRGHYWALDPYAE 139
            .:|:||||.|.:::|||||:|:..|:.||||||||||||..|.:|.|..||||:|:||.|||..|
Zfish   158 QDKKLTLSQIYQYVADNFPFYKKSKAGWQNSIRHNLSLNDCFKKVARDEDDPGKGNYWTLDPNCE 222

  Fly   140 D---------------------------LSIGETTGRLRRSNWQ-QN--TGARPK---------- 164
            .                           |.:.:|:..:..|... ||  |.:.||          
Zfish   223 KMFDNGNFRRKRKRRADGNAMSVKSEDALKLADTSSLMSASQPSLQNSPTSSDPKSSPSPSAEHS 287

  Fly   165 ------------------------------------VTGHPY-----------QRMPYYGHGHGN 182
                                                ::||..           .|:.||...|.|
Zfish   288 PCFSNFIGNMNSIMSGNAVRSRDGSSAHLGDFTQHGMSGHEISPPSEPGHLNTNRLNYYSASHNN 352

  Fly   183 GPYIKAHSAYFPIMDHQHH 201
            ...|.:.|.:|.:.:..:|
Zfish   353 SGLINSISNHFSVNNLIYH 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd19BNP_608369.1 FH 58..135 CDD:238016 44/76 (58%)
foxi1NP_859424.1 Forkhead 141..227 CDD:278670 48/85 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.