DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd19B and slp1

DIOPT Version :9

Sequence 1:NP_608369.1 Gene:fd19B / 33010 FlyBaseID:FBgn0031086 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_476730.1 Gene:slp1 / 33607 FlyBaseID:FBgn0003430 Length:322 Species:Drosophila melanogaster


Alignment Length:301 Identity:100/301 - (33%)
Similarity:147/301 - (48%) Gaps:87/301 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 FQSSFSIRSLLSVDKK---------EESPISKH--------NSGSSFS--------SCSSSSSNS 46
            |:|:|||.::|:  ||         :..|:..|        ||....|        |.:|:..:|
  Fly     8 FKSNFSIDAILA--KKPINTATQPIKTEPVHHHHQYVHPYSNSDGELSASEDFDSPSRTSTPMSS 70

  Fly    47 SSDSMAAKSN--------------------------------------AKPAFTYSALIVMAIWS 73
            :::|:::::|                                      .||.::|:|||:|||..
  Fly    71 AAESLSSQNNDKLDVEFDDELEDQLDEDQESEDGNPSKKQKMTAGSDTKKPPYSYNALIMMAIQD 135

  Fly    74 SSEKRLTLSGICKWIADNFPYYRTRKSVWQNSIRHNLSLNPFFVRVPRALDDPGRGHYWALDPYA 138
            |.|:||||:||.:::.:.|||::..|..||||||||||||..|.::||:.||||:|:||.|||.|
  Fly   136 SPEQRLTLNGIYQYLINRFPYFKANKRGWQNSIRHNLSLNKCFTKIPRSYDDPGKGNYWILDPSA 200

  Fly   139 EDLSIGETTGRLRRSNWQQNTGA-------------RPKVTGHPYQRMPYYGHGHGNGPYIKAHS 190
            |::.||||||:|||    :|.||             .|.:...|| ..|...:|:...|:..|.:
  Fly   201 EEVFIGETTGKLRR----KNPGASRTRLAAYRQAIFSPMMAASPY-GAPASSYGYPAVPFAAAAA 260

  Fly   191 AYFPIMDHQHHAAMVQHYQAMMHRYQMMPHPHHHQHQHQHQ 231
            |  .:....:.||....||.|  :||..|..||||..|..|
  Fly   261 A--ALYQRMNPAAYQAAYQQM--QYQQAPQAHHHQAPHPAQ 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd19BNP_608369.1 FH 58..135 CDD:238016 43/76 (57%)
slp1NP_476730.1 FH 120..205 CDD:214627 48/84 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445502
Domainoid 1 1.000 104 1.000 Domainoid score I1720
eggNOG 1 0.900 - - E2759_KOG2294
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 1 1.000 - - otm46522
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11829
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1751
98.850

Return to query results.
Submit another query.