DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd19B and foxk1

DIOPT Version :9

Sequence 1:NP_608369.1 Gene:fd19B / 33010 FlyBaseID:FBgn0031086 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_956196.1 Gene:foxk1 / 334470 ZFINID:ZDB-GENE-030131-6402 Length:639 Species:Danio rerio


Alignment Length:215 Identity:65/215 - (30%)
Similarity:99/215 - (46%) Gaps:36/215 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 PISKHNSGSS------------------FSSCSSSSSNSSSDSMAAKSNAKPAFTYSALIVMAIW 72
            |.|...:|||                  .:...|.....::...:.|..:||.::|:.|||.||.
Zfish   208 PASPRGAGSSGYRYGRNITSDLQLAAEYAAKAVSEQRTEATGGDSPKDESKPPYSYAQLIVQAIS 272

  Fly    73 SSSEKRLTLSGICKWIADNFPYYRTRKSVWQNSIRHNLSLNPFFVRVPRALDDPGRGHYWALDPY 137
            |:.:::||||||...|..::|||||....||||||||||||.:|::|||:.::||:|.:|.:||.
Zfish   273 SAQDRQLTLSGIYAHITKHYPYYRTADKGWQNSIRHNLSLNRYFIKVPRSQEEPGKGSFWRVDPS 337

  Fly   138 AEDLSIGETTGRLRRSNWQQNTGARPKVTGHPYQRMPYYGHGHGNGPYIKAHSAYFPIMDHQHHA 202
            :| ..:.|...|.||..            |....|.|:......:.|....||...     ..|:
Zfish   338 SE-AKLVEQAFRKRRQR------------GVSCFRTPFGPLSSRSAPASPTHSGLL-----SPHS 384

  Fly   203 AMVQHYQAMMHRYQMMPHPH 222
            :.:|..:.:......:.|.|
Zfish   385 SGLQTPECLSREGSPVSHEH 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd19BNP_608369.1 FH 58..135 CDD:238016 41/76 (54%)
foxk1NP_956196.1 FHA 23..165 CDD:224630
FHA 68..152 CDD:238017
Forkhead 258..344 CDD:278670 44/86 (51%)
Cyto_heme_lyase 370..>465 CDD:279589 7/40 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.