DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd19B and FOXA1

DIOPT Version :9

Sequence 1:NP_608369.1 Gene:fd19B / 33010 FlyBaseID:FBgn0031086 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_004487.2 Gene:FOXA1 / 3169 HGNCID:5021 Length:472 Species:Homo sapiens


Alignment Length:265 Identity:74/265 - (27%)
Similarity:105/265 - (39%) Gaps:57/265 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 SSCSSSSSNSSSDSMAAK---SNAKPAFTYSALIVMAIWSSSEKRLTLSGICKWIADNFPYYRTR 98
            |:...|.:....|:...|   .:|||.::|.:||.|||..:..|.||||.|.:||.|.|||||..
Human   146 SNLGRSRAGGGGDAKTFKRSYPHAKPPYSYISLITMAIQQAPSKMLTLSEIYQWIMDLFPYYRQN 210

  Fly    99 KSVWQNSIRHNLSLNPFFVRVPRALDDPGRGHYWALDPYAEDL-SIGETTGRLRRSNWQQNTGA- 161
            :..|||||||:||.|..||:|.|:.|.||:|.||.|.|.:.:: ..|....|.:|...::..|| 
Human   211 QQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSYWTLHPDSGNMFENGCYLRRQKRFKCEKQPGAG 275

  Fly   162 --------------------RPKVTGHPYQRMPYYGHGHGNGPYIKAHSAYFP-----IMDHQHH 201
                                .|....:|....|.:...||....::...|..|     .:||...
Human   276 GGGGSGSGGSGAKGGPESRKDPSGASNPSADSPLHRGVHGKTGQLEGAPAPGPAASPQTLDHSGA 340

  Fly   202 AAMVQHYQAMMHRYQMMP---------------HPHHHQHQHQHQHPHSHFIQQSKPLHIQEPYH 251
            .|.....:.........|               ||.|....|:.|            ||::...|
Human   341 TATGGASELKTPASSTAPPISSGPGALASVPASHPAHGLAPHESQ------------LHLKGDPH 393

  Fly   252 HTRYH 256
            ::..|
Human   394 YSFNH 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd19BNP_608369.1 FH 58..135 CDD:238016 42/76 (55%)
FOXA1NP_004487.2 Forkhead_N 17..169 CDD:369872 4/22 (18%)
FH_FOXA1 157..268 CDD:410812 50/110 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 269..392 20/134 (15%)
HNF_C 398..461 CDD:401339 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.