Sequence 1: | NP_608369.1 | Gene: | fd19B / 33010 | FlyBaseID: | FBgn0031086 | Length: | 260 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001101441.1 | Gene: | Foxj3 / 313554 | RGDID: | 1311770 | Length: | 622 | Species: | Rattus norvegicus |
Alignment Length: | 414 | Identity: | 105/414 - (25%) |
---|---|---|---|
Similarity: | 144/414 - (34%) | Gaps: | 173/414 - (41%) |
- Green bases have known domain annotations that are detailed below.
Fly 15 SLLSVD-----------KKEESPISKHNSG-SSFSSCSSSSSNSSSDSMAAKSNAKPAFTYSALI 67
Fly 68 VMAIWSSSEKRLTLSGICKWIADNFPYYRTRKSVWQNSIRHNLSLNPFFVRVPRALDDPGRGHYW 132
Fly 133 ALD------------------------PYAED-----------------LSIGETTGRLRRSNWQ 156
Fly 157 QNTGARPK----------------------------VTGHPY--------QRMPYYG-------- 177
Fly 178 ----------------------------------------HGHGNGPYIKAHSAYFPIMDHQH-- 200
Fly 201 -------HA----------AMVQHYQAMMHRYQMMPHPHHH-----QHQHQHQHPHSHFIQQS-- 241
Fly 242 KPLHIQEP------YHHTRYHLHQ 259 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
fd19B | NP_608369.1 | FH | 58..135 | CDD:238016 | 47/76 (62%) |
Foxj3 | NP_001101441.1 | COG5025 | <54..345 | CDD:227358 | 71/292 (24%) |
FH_FOXJ3 | 77..155 | CDD:410826 | 47/77 (61%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1270467at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.920 |