DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd19B and Foxj3

DIOPT Version :9

Sequence 1:NP_608369.1 Gene:fd19B / 33010 FlyBaseID:FBgn0031086 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001101441.1 Gene:Foxj3 / 313554 RGDID:1311770 Length:622 Species:Rattus norvegicus


Alignment Length:414 Identity:105/414 - (25%)
Similarity:144/414 - (34%) Gaps:173/414 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 SLLSVD-----------KKEESPISKHNSG-SSFSSCSSSSSNSSSDSMAAKSNAKPAFTYSALI 67
            ||.|:|           :|.::..:.|.:| |..::....::....:.:....:.||.::|::||
  Rat    23 SLTSMDWLPQLTMRAAIQKSDATQNAHGTGISKKNALLDPNTTLDQEEVQQHKDGKPPYSYASLI 87

  Fly    68 VMAIWSSSEKRLTLSGICKWIADNFPYYRTRKSVWQNSIRHNLSLNPFFVRVPRALDDPGRGHYW 132
            ..||.||.:|::|||.|.:||.|||||||...|.|:||||||||||..|::|||:.||||:|.||
  Rat    88 TFAINSSPKKKMTLSEIYQWICDNFPYYREAGSGWKNSIRHNLSLNKCFLKVPRSKDDPGKGSYW 152

  Fly   133 ALD------------------------PYAED-----------------LSIGETTGRLRRSNWQ 156
            |:|                        ||:.|                 |:|...|.::...|..
  Rat   153 AIDTNPKEDTLPTRPKKRARSVERASTPYSIDSDSLGMECIISGSASPTLAINTVTNKVTLYNTD 217

  Fly   157 QNTGARPK----------------------------VTGHPY--------QRMPYYG-------- 177
            |:....|:                            ||.||.        |:.|.|.        
  Rat   218 QDGSDSPRSSLNNSLSDQSLASVNLNSVGSVHSYTPVTNHPEPVSQSLTPQQQPQYNLPERDKQL 282

  Fly   178 ----------------------------------------HGHGNGPYIKAHSAYFPIMDHQH-- 200
                                                    ..|.:..|  .||....:..|.|  
  Rat   283 LFTEYNFEDLSASFRSLYKSVFEQSLSQQGLMSIPSESSQQSHTSCSY--QHSPSSTVTSHPHSN 345

  Fly   201 -------HA----------AMVQHYQAMMHRYQMMPHPHHH-----QHQHQHQHPHSHFIQQS-- 241
                   |:          |.|......||. |..||..|.     ||..:.|||.||..|.|  
  Rat   346 QSSLPNNHSGLSATGSNSVAQVSLSHPQMHT-QPSPHTPHRPHGLPQHPQRPQHPASHPQQHSQL 409

  Fly   242 KPLHIQEP------YHHTRYHLHQ 259
            :|.|.|.|      .||.. |.||
  Rat   410 QPPHSQHPPPHQHIQHHPN-HQHQ 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd19BNP_608369.1 FH 58..135 CDD:238016 47/76 (62%)
Foxj3NP_001101441.1 COG5025 <54..345 CDD:227358 71/292 (24%)
FH_FOXJ3 77..155 CDD:410826 47/77 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.