DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd19B and foxa3

DIOPT Version :9

Sequence 1:NP_608369.1 Gene:fd19B / 33010 FlyBaseID:FBgn0031086 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_571374.1 Gene:foxa3 / 30559 ZFINID:ZDB-GENE-980526-423 Length:441 Species:Danio rerio


Alignment Length:306 Identity:89/306 - (29%)
Similarity:128/306 - (41%) Gaps:69/306 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDTTPIFQSSFSIRSLLSVDKKEES--PISKHNS-GSSFSSCSSSSSNSSSDS-------MAAKS 55
            |..:|: .||.:..||..:.....:  |:|.:.| |...|..|..|..|.:.:       ..:.:
Zfish    77 MSLSPV-GSSLNPSSLTQLGSSASTLGPLSHYQSMGQPMSQISYPSPTSLNRTKEMPKPYRRSLT 140

  Fly    56 NAKPAFTYSALIVMAIWSSSEKRLTLSGICKWIADNFPYYRTRKSVWQNSIRHNLSLNPFFVRVP 120
            :|||.::|.:||.|||..|..|.|||:.|.:||.|.|||||..:..|||||||:||.|..||:|.
Zfish   141 HAKPPYSYISLITMAIQQSQSKMLTLNEIYQWIMDLFPYYRENQQRWQNSIRHSLSFNDCFVKVA 205

  Fly   121 RALDDPGRGHYWALDPYAEDL-------------SIGETTGRLRRSNWQQNTGARPKVT----GH 168
            |:.|.||:|.||||.|.:.::             .|.|..|  ::|:.:...|:..|.|    |.
Zfish   206 RSPDKPGKGSYWALHPNSGNMFENGCYLRRQKRFKIEEKAG--KKSSSKSQDGSSTKGTHSSEGM 268

  Fly   169 PYQRMPYYGHGHGNGPYIKAHSAYFPIMDHQHHAAMVQHYQA-------------MMHRYQM--- 217
            ..:..|..|.....    .|||      |..|..:..:..|.             ::|...:   
Zfish   269 QEEHSPTTGSDGAE----SAHS------DSSHAGSTSEEQQRSLVQLDCPSQAPNLLHSSPVPIP 323

  Fly   218 ------MPHPHHHQH-QHQHQHPH------SHFIQQSKPLHIQEPY 250
                  ||....|.| |.....||      .|...|:.||...:|:
Zfish   324 SSVSASMPPSSSHLHSQGMGNSPHLLGSPMHHLDLQNDPLKSMDPH 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd19BNP_608369.1 FH 58..135 CDD:238016 43/76 (57%)
foxa3NP_571374.1 Forkhead_N 17..142 CDD:254796 14/65 (22%)
FH 143..231 CDD:214627 45/87 (52%)
HNF_C 374..>408 CDD:286443
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.