DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd19B and foxb1a

DIOPT Version :9

Sequence 1:NP_608369.1 Gene:fd19B / 33010 FlyBaseID:FBgn0031086 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_571360.1 Gene:foxb1a / 30542 ZFINID:ZDB-GENE-990616-47 Length:297 Species:Danio rerio


Alignment Length:200 Identity:63/200 - (31%)
Similarity:91/200 - (45%) Gaps:25/200 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 SNAKPAFTYSALIVMAIWSSSEKRLTLSGICKWIADNFPYYRTRKSVWQNSIRHNLSLNPFFVRV 119
            |:.||.::|.:|..|||.|..||.|.||.|.|:|.|.|||||.....||||:|||||.|..|:::
Zfish    10 SDQKPPYSYISLTAMAIQSCPEKMLPLSEIYKFIMDRFPYYRENTQRWQNSLRHNLSFNDCFIKI 74

  Fly   120 PRALDDPGRGHYWALDPYAEDLSIGETTGRLRRSNWQQNTG-----ARPKVTGHPYQRMPYYGHG 179
            ||..|.||:|.:|||.|...|:....:..| ||..::..|.     ::|....|           
Zfish    75 PRRPDQPGKGSFWALHPSCGDMFENGSFLR-RRKRFKVMTSEHLAPSKPSDAAH----------- 127

  Fly   180 HGNGPYIKAHSAYFPIMDHQHHAAMVQHYQAMMHRYQMMPHPHHHQH--QHQHQHPHSHFIQQSK 242
                 |::.| |...:.....|...:..|...:.:.....||...::  ..:::.|.........
Zfish   128 -----YLQQH-AKLRLSALGTHLPQMSSYNLGVSQPSTFKHPFAIENIIAREYKVPGGLAFSTGY 186

  Fly   243 PLHIQ 247
            |||.|
Zfish   187 PLHNQ 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd19BNP_608369.1 FH 58..135 CDD:238016 41/76 (54%)
foxb1aNP_571360.1 FH 13..101 CDD:214627 44/87 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.