DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd19B and foxa1

DIOPT Version :9

Sequence 1:NP_608369.1 Gene:fd19B / 33010 FlyBaseID:FBgn0031086 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_571359.2 Gene:foxa1 / 30541 ZFINID:ZDB-GENE-990415-78 Length:427 Species:Danio rerio


Alignment Length:270 Identity:81/270 - (30%)
Similarity:121/270 - (44%) Gaps:61/270 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 SKHNSGSSFSSCSSSSSNSSSDSMA------AKSN---------AKPAFTYSALIVMAIWSSSEK 77
            ::|:|.::.:..:|.|...||.:.|      |:.|         |||.::|.:||.|||..:..|
Zfish   112 AQHSSMNALNPYTSMSPTMSSMTYAQPNLNRARDNKTFRRSYPHAKPPYSYISLITMAIQQAPSK 176

  Fly    78 RLTLSGICKWIADNFPYYRTRKSVWQNSIRHNLSLNPFFVRVPRALDDPGRGHYWALDPYAEDLS 142
            .||||.|.:||.|.|||||..:..|||||||:||.|..||:|.|:.|.||:|.||.|.|  :..:
Zfish   177 MLTLSEIYQWIMDLFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPDKPGKGSYWTLHP--DSGN 239

  Fly   143 IGETTGRLRRS----------NWQQNTGARPKV--TGHPYQRMPYYGHGHGNGPYIKA--HSAYF 193
            :.|....|||.          :.:::.|.|.:.  :|.|..........|.:...|.:  .|:..
Zfish   240 MFENGCYLRRQKRFKCDKKLPDGKRSEGKREQSSGSGSPASDSTSSKPVHMDSSSITSSNQSSSP 304

  Fly   194 PIMDH---------------QHH--AAMVQHYQAMMHRYQMMPH----PHHHQHQHQHQHPHS-- 235
            |.:||               |.|  :..:....:|.|..|:  |    ||     :...||.|  
Zfish   305 PSLDHRSGSSANSELKSGGPQVHPVSTSLSSLHSMAHESQL--HLKGDPH-----YSFNHPFSIN 362

  Fly   236 HFIQQSKPLH 245
            :.:..|:..|
Zfish   363 NLMSSSEQQH 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd19BNP_608369.1 FH 58..135 CDD:238016 42/76 (55%)
foxa1NP_571359.2 Forkhead_N 17..156 CDD:254796 9/43 (21%)
FH 157..245 CDD:214627 45/89 (51%)
HNF_C 357..416 CDD:286443 5/16 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.