DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd19B and foxd2

DIOPT Version :9

Sequence 1:NP_608369.1 Gene:fd19B / 33010 FlyBaseID:FBgn0031086 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_571346.2 Gene:foxd2 / 30525 ZFINID:ZDB-GENE-980605-6 Length:369 Species:Danio rerio


Alignment Length:252 Identity:81/252 - (32%)
Similarity:117/252 - (46%) Gaps:63/252 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 VDKKEESPISKHNSGSSFSSCSSSSSNSSSDSMAAKSNA----------------KPAFTYSALI 67
            :|...:..:|: |:|....|...||.:..:|.:..:.::                ||.::|.|||
Zfish    41 LDNDSDDNLSQ-NAGEGAISPGQSSLDCPADRVGQRDDSRTGALTGDKPGKNALVKPPYSYIALI 104

  Fly    68 VMAIWSSSEKRLTLSGICKWIADNFPYYRTRKSVWQNSIRHNLSLNPFFVRVPRALDDPGRGHYW 132
            .|||..|.:||||||.||::|::.|||||.:...||||||||||||..||::||...:||:|:||
Zfish   105 TMAILQSPKKRLTLSEICEFISNRFPYYREKFPAWQNSIRHNLSLNDCFVKIPREPGNPGKGNYW 169

  Fly   133 ALDPYAEDL-SIGETTGRLRRSNWQQNTGARPKVTGHPYQRMPYYGHGHGNGPYIKAHSAYFPIM 196
            .|||.:.|: ..|....|.:|....|......:..|.    :|    |.|.|||     .|    
Zfish   170 TLDPESADMFDNGSFLRRRKRFKRHQTNEILREAGGF----LP----GFGYGPY-----GY---- 217

  Fly   197 DHQHHAAMVQHYQAMMHRYQMMPHPHHHQHQHQHQHPHSHFIQQSKPLHIQEPYHHT 253
               ::...:|::           |.||..|.|   ||.|.|           |:.:|
Zfish   218 ---NYGLQLQNF-----------HAHHPYHPH---HPGSAF-----------PFQNT 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd19BNP_608369.1 FH 58..135 CDD:238016 45/76 (59%)
foxd2NP_571346.2 Forkhead 95..181 CDD:278670 49/85 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.