DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd19B and Foxk2

DIOPT Version :9

Sequence 1:NP_608369.1 Gene:fd19B / 33010 FlyBaseID:FBgn0031086 Length:260 Species:Drosophila melanogaster
Sequence 2:XP_006247952.1 Gene:Foxk2 / 303753 RGDID:1305408 Length:650 Species:Rattus norvegicus


Alignment Length:196 Identity:67/196 - (34%)
Similarity:99/196 - (50%) Gaps:35/196 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 SVDKKEESPISKHNSGSSF--------SSCSSSSSNS-------SSDSMAAKSNAKPAFTYSALI 67
            ::......|.|...:|||.        |..:..:.||       :|...:.|.::||.::|:.||
  Rat   194 TISAANSCPSSPRGAGSSGYKMGRVIPSDLNLMADNSQPENEKEASGGDSPKDDSKPPYSYAQLI 258

  Fly    68 VMAIWSSSEKRLTLSGICKWIADNFPYYRTRKSVWQNSIRHNLSLNPFFVRVPRALDDPGRGHYW 132
            |.||..:.:|:|||:||...|..|:|||||....||||||||||||.:|::|||:.::||:|.:|
  Rat   259 VQAITMAPDKQLTLNGIYTHITKNYPYYRTADKGWQNSIRHNLSLNRYFIKVPRSQEEPGKGSFW 323

  Fly   133 ALDPYAEDLSIGETTGRLRRSNWQQNTGARPKVTGHPYQRMPYYGHGHGNGP-------YIKAHS 190
            .:|| |.:..:.|...|.|          ||:  |.|..|.|.......:.|       .:.|||
  Rat   324 RIDP-ASESKLVEQAFRKR----------RPR--GVPCFRTPLGPLSSRSAPASPNHAGVLSAHS 375

  Fly   191 A 191
            :
  Rat   376 S 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd19BNP_608369.1 FH 58..135 CDD:238016 41/76 (54%)
Foxk2XP_006247952.1 FHA 41..145 CDD:238017
Forkhead 249..335 CDD:278670 44/86 (51%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.