DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd19B and foxa2

DIOPT Version :9

Sequence 1:NP_608369.1 Gene:fd19B / 33010 FlyBaseID:FBgn0031086 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_571024.1 Gene:foxa2 / 30126 ZFINID:ZDB-GENE-980526-404 Length:409 Species:Danio rerio


Alignment Length:269 Identity:80/269 - (29%)
Similarity:119/269 - (44%) Gaps:58/269 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 SPISKH----NSGSSFSSCSS-------SSSNSSSDSMAAK---SNAKPAFTYSALIVMAIWSSS 75
            ||::..    |:.:|:|:.::       |:.|.|.|....:   ::|||.::|.:||.|||..|.
Zfish   104 SPMAAQAPSMNALTSYSNMNAMSPMYGQSNINRSRDPKTYRRSYTHAKPPYSYISLITMAIQQSP 168

  Fly    76 EKRLTLSGICKWIADNFPYYRTRKSVWQNSIRHNLSLNPFFVRVPRALDDPGRGHYWALDPYAED 140
            .|.||||.|.:||.|.||:||..:..|||||||:||.|..|::|||:.|.||:|.:|.|.|  :.
Zfish   169 SKMLTLSEIYQWIMDLFPFYRQNQQRWQNSIRHSLSFNDCFLKVPRSPDKPGKGSFWTLHP--DS 231

  Fly   141 LSIGETTGRLRRSNWQQNTGARPKVTGHPYQRMPYYGHG------------HGN----------- 182
            .::.|....|||   |:......|::..|.::....|..            |.|           
Zfish   232 GNMFENGCYLRR---QKRFKCDKKLSKDPSRKTSEGGSNSSSESCNGNESPHSNSSSNELKRSLS 293

  Fly   183 ----GPYIKAHSAYFPIMDHQHHAAMVQHYQAMMHRYQMMPHPHHHQHQHQHQHPHSHFIQQSKP 243
                |..:....|..|....||  .:.||:..:.|...:.|     :|.:...||.|     ...
Zfish   294 DMKSGQGLSPDHAASPTSQAQH--LLAQHHSVLAHEGHLKP-----EHHYSFNHPFS-----INN 346

  Fly   244 LHIQEPYHH 252
            |...|..||
Zfish   347 LMSSEQQHH 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd19BNP_608369.1 FH 58..135 CDD:238016 41/76 (54%)
foxa2NP_571024.1 Forkhead_N 18..150 CDD:254796 9/45 (20%)
FH 151..239 CDD:214627 44/89 (49%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 250..315 8/64 (13%)
HNF_C 340..398 CDD:286443 7/21 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.