DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd19B and Foxd3

DIOPT Version :9

Sequence 1:NP_608369.1 Gene:fd19B / 33010 FlyBaseID:FBgn0031086 Length:260 Species:Drosophila melanogaster
Sequence 2:XP_008762182.2 Gene:Foxd3 / 29203 RGDID:621715 Length:469 Species:Rattus norvegicus


Alignment Length:257 Identity:80/257 - (31%)
Similarity:115/257 - (44%) Gaps:65/257 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LSVDKKEES-PISKHNSGSSFSSCS--SSSSNSSSDSMAAKSN---------------------- 56
            |.:|:.:|. |.|.|:..|...:.:  |.::...:|:.|.:::                      
  Rat    53 LRLDEADEGLPASAHHGQSQPQALALPSEATGPGNDTGAPEADGCKGGEDAVTGGGGPGAGGGAT 117

  Fly    57 ------------AKPAFTYSALIVMAIWSSSEKRLTLSGICKWIADNFPYYRTRKSVWQNSIRHN 109
                        .||.::|.|||.|||..|.:|:|||||||::|::.|||||.:...||||||||
  Rat   118 GGLTPNKPKNSLVKPPYSYIALITMAILQSPQKKLTLSGICEFISNRFPYYREKFPAWQNSIRHN 182

  Fly   110 LSLNPFFVRVPRALDDPGRGHYWALDPYAEDL-SIGETTGRLRRSNWQQNTGARPK--------- 164
            ||||..||::||...:||:|:||.|||.:||: ..|....|.:|....|....|.:         
  Rat   183 LSLNDCFVKIPREPGNPGKGNYWTLDPQSEDMFDNGSFLRRRKRFKRHQQEHLREQTALMMQSFG 247

  Fly   165 -------VTGHPYQRMPYYGHGHGNGPYIKAHSAYFPIMDHQHHAAMVQHYQAMMHRYQMMP 219
                   .:..||.| ||..|.      ..|..||    .|...||......|:.:.|.:.|
  Rat   248 AYSLAAAASAGPYGR-PYGLHP------AAAAGAY----SHPAAAAAAAAAAALQYPYALPP 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd19BNP_608369.1 FH 58..135 CDD:238016 45/76 (59%)
Foxd3XP_008762182.2 FH_FOXD3 130..226 CDD:410821 52/95 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.