DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd19B and Foxl2

DIOPT Version :9

Sequence 1:NP_608369.1 Gene:fd19B / 33010 FlyBaseID:FBgn0031086 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_036150.1 Gene:Foxl2 / 26927 MGIID:1349428 Length:375 Species:Mus musculus


Alignment Length:325 Identity:87/325 - (26%)
Similarity:111/325 - (34%) Gaps:126/325 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 SVDKKEESPISKHNSGSSFSSCSSSSSNSSSDSMAAKSNAKPAFTYSALIVMAIWSSSEKRLTLS 82
            :|.:.|.||.|....|.:.......:.             ||.::|.|||.|||..|:|||||||
Mouse    23 AVKEAEASPPSPGKGGGTTPEKPDPAQ-------------KPPYSYVALIAMAIRESAEKRLTLS 74

  Fly    83 GICKWIADNFPYYRTRKSVWQNSIRHNLSLNPFFVRVPRALDDPGRGHYWALDPYAEDLSIGETT 147
            ||.::|...||:|...|..||||||||||||..|::|||......:|:||.|||..||:......
Mouse    75 GIYQYIIAKFPFYEKNKKGWQNSIRHNLSLNECFIKVPREGGGERKGNYWTLDPACEDMFEKGNY 139

  Fly   148 GRLRR---------SNWQQNTG------------------------ARPKV--TG---------H 168
            .|.||         :::|...|                        |.||.  :|         .
Mouse   140 RRRRRMKRPFRPPPAHFQPGKGLFGSGGAAGGCGVPGAGADGYGYLAPPKYLQSGFLNNSWPLPQ 204

  Fly   169 PYQRMPY---------------------------------YGHGHGNGPYIKAHSAYFPIMDHQH 200
            |...|||                                 .|.....|||.:..|...|      
Mouse   205 PPSPMPYASCQMAAAAAAAAAAAAAAGPGSPGAAAVVKGLAGPAASYGPYSRVQSMALP------ 263

  Fly   201 HAAMVQHYQAMMHRYQMM-------------PHPHHHQHQHQHQHPHSHFIQQSKPLHIQEPYHH 252
                    ..:::.|..:             ||||.|.|.|     |.|......|    .|.||
Mouse   264 --------PGVVNSYNGLGGPPAAPPPPPPPPHPHPHPHAH-----HLHAAAAPPP----APPHH 311

  Fly   253  252
            Mouse   312  311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd19BNP_608369.1 FH 58..135 CDD:238016 43/76 (57%)
Foxl2NP_036150.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..50 6/39 (15%)
FH 50..138 CDD:214627 48/87 (55%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 272..341 13/49 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.