DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd19B and mei4

DIOPT Version :9

Sequence 1:NP_608369.1 Gene:fd19B / 33010 FlyBaseID:FBgn0031086 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_595617.1 Gene:mei4 / 2540241 PomBaseID:SPBC32H8.11 Length:517 Species:Schizosaccharomyces pombe


Alignment Length:175 Identity:64/175 - (36%)
Similarity:86/175 - (49%) Gaps:25/175 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LLSVDKKEESPISKHNSGSSFSS---CSS-------SSSNSSSDSMA-----------AKSNAKP 59
            :||:..||.|.|:...:.|:.||   |.:       :..|.||||:.           ..:..||
pombe    18 ILSLSLKESSKINDSQNVSNVSSKEKCETEALLREENKENLSSDSIRQMIFGDEMAGFVDTGEKP 82

  Fly    60 AFTYSALIVMAIWSSSEKRLTLSGICKWIADNFPYYRTRKSVWQNSIRHNLSLNPFFVRVPRALD 124
            ..:|:.||.:||..|..|:||||||..||.:.|.||......||||||||||||..|::|.:...
pombe    83 PCSYATLIGLAILQSHNKQLTLSGIYTWIRNTFRYYLNHDGGWQNSIRHNLSLNKAFIKVEKPKG 147

  Fly   125 DPGRGHYWALDPYAEDLSIGETTGRLRRS-NWQQNTGARPKVTGH 168
            ...:||||.:||   |......:.||.|| :...|:..||....|
pombe   148 KTLKGHYWTIDP---DHMQNFVSVRLHRSHSTDSNSKKRPSSKCH 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd19BNP_608369.1 FH 58..135 CDD:238016 38/76 (50%)
mei4NP_595617.1 COG5025 1..517 CDD:227358 64/175 (37%)
Forkhead 81..167 CDD:278670 41/88 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 104 1.000 Domainoid score I1720
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 1 1.000 - - otm47190
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.870

Return to query results.
Submit another query.