DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd19B and fkh2

DIOPT Version :9

Sequence 1:NP_608369.1 Gene:fd19B / 33010 FlyBaseID:FBgn0031086 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_596764.1 Gene:fkh2 / 2539703 PomBaseID:SPBC16G5.15c Length:642 Species:Schizosaccharomyces pombe


Alignment Length:326 Identity:85/326 - (26%)
Similarity:125/326 - (38%) Gaps:97/326 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 QSSFSIRSLLSVDKKEESPISKHNSGSSFSSCSSSSSNSSSDSMAAKSNAKPAFTYSALIVMAIW 72
            |..|.:.:.....:.:||.|.:       .:..|..|.:.:|:.....|.||.::||.:|..||.
pombe   180 QMMFVLPNAAEQKQTDESTIKE-------DAIKSEISAAVNDAAEYGDNKKPPYSYSVMIAQAIL 237

  Fly    73 SSSEKRLTLSGICKWIADNFPYYRTRKSVWQNSIRHNLSLNPFFVRVPRALDDPGRGHYWALDPY 137
            ||||..:|||.|..||:.::|||||.||.||||||||||||..|.:|||...:.|:|..|::.|.
pombe   238 SSSECMMTLSNIYSWISTHYPYYRTTKSGWQNSIRHNLSLNKAFRKVPRKSGEQGKGMKWSIVPE 302

  Fly   138 AEDLSIGET--TGRLR----------------------------------------RSNWQQNTG 160
            ..:..|.:|  |.|.|                                        .::.:..|.
pombe   303 FREEFIAKTRKTPRKRSPSSPVPLLAKKREGSPSLPIPILPKMKDTSIPAAEPASSTTSARDQTP 367

  Fly   161 ARPKVTGHP--------YQRMPYYGHGHGNGPYIKAHSAYFPIMDHQHHAAMVQHYQ-------- 209
            :.||..|.|        .::|..|        ....|:|...|:....:|.......        
pombe   368 STPKDVGSPSTAETSAEEKQMETY--------KTPTHAALSDIISTHDYALDANSASQTKKAAFG 424

  Fly   210 -------------AMMHRYQMMPHPH------HHQHQHQHQHP-HSHF----IQQSKPLHIQEPY 250
                         |...:|..:|:||      .:.....:::| :||.    ||||.|..|.|..
pombe   425 SPIGSSTYPTSSPAPFWKYVAVPNPHDWPQVGSYDTISPYRNPVNSHLIYSQIQQSSPKKIDEQL 489

  Fly   251 H 251
            |
pombe   490 H 490

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd19BNP_608369.1 FH 58..135 CDD:238016 43/76 (57%)
fkh2NP_596764.1 COG5025 6..622 CDD:227358 85/326 (26%)
FHA 81..185 CDD:238017 2/4 (50%)
Forkhead 223..308 CDD:278670 44/84 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 104 1.000 Domainoid score I1720
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 1 1.000 - - otm47009
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.