DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd19B and Foxd4

DIOPT Version :9

Sequence 1:NP_608369.1 Gene:fd19B / 33010 FlyBaseID:FBgn0031086 Length:260 Species:Drosophila melanogaster
Sequence 2:XP_001055972.2 Gene:Foxd4 / 252886 RGDID:621716 Length:432 Species:Rattus norvegicus


Alignment Length:230 Identity:76/230 - (33%)
Similarity:110/230 - (47%) Gaps:39/230 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 NSGSSFSSCSSSSSNSSSDSMAAKSNAKPAFTYSALIVMAIWSSSEKRLTLSGICKWIADNFPYY 95
            ||........:..:.:::.:......|||.::|.|||.|||..|..|||||||||.:|:..||||
  Rat    76 NSSGFLRKFRAPRTRATTTTADGPQPAKPPYSYIALITMAILQSPHKRLTLSGICAFISGRFPYY 140

  Fly    96 RTRKSVWQNSIRHNLSLNPFFVRVPRALDDPGRGHYWALDPYAEDLSIGETTGRLRRSNWQQNTG 160
            |.:...||||||||||||..||::||....||:|:||:|||.::|:....:..| ||..::::  
  Rat   141 RRKFPAWQNSIRHNLSLNDCFVKIPREPGHPGKGNYWSLDPASQDMFDNGSFLR-RRKRFKRH-- 202

  Fly   161 ARPKVTGHPYQRMPYYGHGHGNGPYIKAHSAYFPIMDHQHHAAMVQHYQ-AMMHRYQMMPHPHHH 224
             .|...|||:...|        .|.:               .|.||..| .::.||...|.|:..
  Rat   203 -HPPPGGHPHCPFP--------PPAV---------------PATVQVSQPGLLLRYSAPPQPNLA 243

  Fly   225 QHQHQ----------HQHPHSHFIQQSKPLHIQEP 249
            .|...          |.:| ..::..:.|.:..||
  Rat   244 VHPASPPRSRPCAPLHPYP-LRYLLLAAPAYADEP 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd19BNP_608369.1 FH 58..135 CDD:238016 46/76 (61%)
Foxd4XP_001055972.2 Forkhead 103..189 CDD:278670 50/85 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.