DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd19B and Foxa3

DIOPT Version :10

Sequence 1:NP_608369.1 Gene:fd19B / 33010 FlyBaseID:FBgn0031086 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001420666.1 Gene:Foxa3 / 25100 RGDID:2809 Length:361 Species:Rattus norvegicus


Alignment Length:82 Identity:46/82 - (56%)
Similarity:58/82 - (70%) Gaps:0/82 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 SNAKPAFTYSALIVMAIWSSSEKRLTLSGICKWIADNFPYYRTRKSVWQNSIRHNLSLNPFFVRV 119
            ::|||.::|.:||.|||..:..|.||||.|.:||.|.|||||..:..|||||||:||.|..||:|
  Rat   123 AHAKPPYSYISLITMAIQQAPGKMLTLSEIYQWIMDLFPYYRENQQRWQNSIRHSLSFNDCFVKV 187

  Fly   120 PRALDDPGRGHYWALDP 136
            .|:.|.||:|.||||.|
  Rat   188 ARSPDKPGKGSYWALHP 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd19BNP_608369.1 Forkhead 58..140 CDD:459732 45/79 (57%)
Foxa3NP_001420666.1 FH_FOXA3 124..225 CDD:410814 46/81 (57%)

Return to query results.
Submit another query.