DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd19B and FOXJ1

DIOPT Version :9

Sequence 1:NP_608369.1 Gene:fd19B / 33010 FlyBaseID:FBgn0031086 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001445.2 Gene:FOXJ1 / 2302 HGNCID:3816 Length:421 Species:Homo sapiens


Alignment Length:123 Identity:56/123 - (45%)
Similarity:74/123 - (60%) Gaps:8/123 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 HNSGSSFSSCSSSSSNSSSDS-------MAAKSNAKPAFTYSALIVMAIWSSSEKRLTLSGICKW 87
            |..|...|||:|.|:.....:       .|...:.||.::|:.||.||:.:|...::|||.|.||
Human    86 HTPGKPTSSCTSRSAPPGLQAPPPDDVDYATNPHVKPPYSYATLICMAMQASKATKITLSAIYKW 150

  Fly    88 IADNFPYYRTRKSVWQNSIRHNLSLNPFFVRVPRALDDPGRGHYWALDP-YAEDLSIG 144
            |.|||.|:|.....||||||||||||..|::|||..|:||:|.:|.:|| |||.|..|
Human   151 ITDNFCYFRHADPTWQNSIRHNLSLNKCFIKVPREKDEPGKGGFWRIDPQYAERLLSG 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd19BNP_608369.1 FH 58..135 CDD:238016 41/76 (54%)
FOXJ1NP_001445.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..34
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 48..116 7/29 (24%)
Forkhead 121..205 CDD:306709 46/83 (55%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 261..302
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.