DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd19B and FOXL1

DIOPT Version :9

Sequence 1:NP_608369.1 Gene:fd19B / 33010 FlyBaseID:FBgn0031086 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_005241.1 Gene:FOXL1 / 2300 HGNCID:3817 Length:345 Species:Homo sapiens


Alignment Length:167 Identity:68/167 - (40%)
Similarity:89/167 - (53%) Gaps:24/167 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 SMAAKSNA----KPAFTYSALIVMAIWSSSEKRLTLSGICKWIADNFPYYRTRKSVWQNSIRHNL 110
            ::||...|    ||.::|.|||.|||..:.|:|:||:||.::|.|.||:|...:..|||||||||
Human    37 ALAASGRAETPQKPPYSYIALIAMAIQDAPEQRVTLNGIYQFIMDRFPFYHDNRQGWQNSIRHNL 101

  Fly   111 SLNPFFVRVPRALDDPGRGHYWALDPYAEDLSIGETTGRLRRSNWQQNTG------ARPKVTGHP 169
            |||..||:|||....||:|.||.|||...|:.   ..|..||...:...|      .||:...| 
Human   102 SLNDCFVKVPREKGRPGKGSYWTLDPRCLDMF---ENGNYRRRKRKPKPGPGAPEAKRPRAETH- 162

  Fly   170 YQR----MPYYGHG-HGNGPYIK----AHSAYFPIMD 197
             ||    .|..|.| .|:||.|.    |.:...|::|
Human   163 -QRSAEAQPEAGSGAGGSGPAISRLQAAPAGPSPLLD 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd19BNP_608369.1 FH 58..135 CDD:238016 42/76 (55%)
FOXL1NP_005241.1 FH 49..137 CDD:214627 46/90 (51%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 136..289 19/65 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.