DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd19B and FOXD1

DIOPT Version :9

Sequence 1:NP_608369.1 Gene:fd19B / 33010 FlyBaseID:FBgn0031086 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_004463.1 Gene:FOXD1 / 2297 HGNCID:3802 Length:465 Species:Homo sapiens


Alignment Length:216 Identity:77/216 - (35%)
Similarity:97/216 - (44%) Gaps:41/216 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 SSSNSSSDSMAAKSNAKPAFTYSALIVMAIWSSSEKRLTLSGICKWIADNFPYYRTRKSVWQNSI 106
            :....|:.|.|.....||.::|.|||.|||..|.:||||||.||::|:..|||||.:...|||||
Human   109 AGGGGSAGSGAKNPLVKPPYSYIALITMAILQSPKKRLTLSEICEFISGRFPYYREKFPAWQNSI 173

  Fly   107 RHNLSLNPFFVRVPRALDDPGRGHYWALDPYAEDL-SIGETTGRLRRSNWQ-------------- 156
            |||||||..||::||...:||:|:||.|||.:.|: ..|....|.:|...|              
Human   174 RHNLSLNDCFVKIPREPGNPGKGNYWTLDPESADMFDNGSFLRRRKRFKRQPLLPPNAAAAESLL 238

  Fly   157 -QNTGA----------------RPKVTGHPYQRMPY-YGHGHGNGPYIKAHSAYFPIMDHQHHAA 203
             :..||                .|....|.|...|| .|:|....||... ||.|.       ||
Human   239 LRGAGAAGGAGDPAAAAALFPPAPPPPPHAYGYGPYGCGYGLQLPPYAPP-SALFA-------AA 295

  Fly   204 MVQHYQAMMHRYQMMPHPHHH 224
            ......|..|.:...|.|..|
Human   296 AAAAAAAAFHPHSPPPPPPPH 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd19BNP_608369.1 FH 58..135 CDD:238016 45/76 (59%)
FOXD1NP_004463.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..117 1/7 (14%)
Forkhead 125..211 CDD:278670 49/85 (58%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 391..410
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.