DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment fd19B and FOXC1

DIOPT Version :9

Sequence 1:	NP_608369.1	Gene:	fd19B / 33010	FlyBaseID:	FBgn0031086	Length:	260	Species:	Drosophila melanogaster
Sequence 2:	NP_001444.2	Gene:	FOXC1 / 2296	HGNCID:	3800	Length:	553	Species:	Homo sapiens

Alignment Length:	99	Identity:	51/99 - (51%)
Similarity:	67/99 - (67%)	Gaps:	2/99 - (2%)

- Green bases have known domain annotations that are detailed below.

  Fly    54 KSNAKPAFTYSALIVMAIWSSSEKRLTLSGICKWIADNFPYYRTRKSVWQNSIRHNLSLNPFFVR 118
            |...||.::|.|||.|||.::.:|::||:||.::|.|.||:||..|..||||||||||||..||:
Human    74 KDMVKPPYSYIALITMAIQNAPDKKITLNGIYQFIMDRFPFYRDNKQGWQNSIRHNLSLNECFVK 138

  Fly   119 VPRALDDPGRGHYWALDPYAEDLSIGETTGRLRR 152
            |||....||:|.||.|||  :..::.|....|||
Human   139 VPRDDKKPGKGSYWTLDP--DSYNMFENGSFLRR 170

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
fd19B	NP_608369.1	FH	58..135	CDD:238016	43/76 (57%)
FOXC1	NP_001444.2	Required for transcriptional activation. /evidence=ECO:0000269\|PubMed:11782474	1..51
		FH	78..166	CDD:214627	47/89 (53%)
		Nuclear localization signal 1 (NLS 1). /evidence=ECO:0000269\|PubMed:11782474	78..93		9/14 (64%)
		Nuclear localization signal 2 (NLS 2). /evidence=ECO:0000269\|PubMed:11782474	168..176		3/3 (100%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	173..310
		Required for transcriptional inhibition. /evidence=ECO:0000269\|PubMed:11782474	215..366
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	356..387
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	414..465
		Required for transcriptional activation. /evidence=ECO:0000269\|PubMed:11782474	466..553
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D1270467at2759
OrthoFinder	1	1.000	-	-		FOG0000010
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	O	PTHR11829
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	4	4.020