DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd19B and FOXJ3

DIOPT Version :9

Sequence 1:NP_608369.1 Gene:fd19B / 33010 FlyBaseID:FBgn0031086 Length:260 Species:Drosophila melanogaster
Sequence 2:XP_005270689.1 Gene:FOXJ3 / 22887 HGNCID:29178 Length:630 Species:Homo sapiens


Alignment Length:409 Identity:99/409 - (24%)
Similarity:140/409 - (34%) Gaps:171/409 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 SLLSVD-----------KKEESPISKHNSG-SSFSSCSSSSSNSSSDSMAAKSNAKPAFTYSALI 67
            ||.|:|           :|.::..:.|.:| |..::....::....:.:....:.||.::|::||
Human    31 SLTSMDWLPQLTMRAAIQKSDATQNAHGTGISKKNALLDPNTTLDQEEVQQHKDGKPPYSYASLI 95

  Fly    68 VMAIWSSSEKRLTLSGICKWIADNFPYYRTRKSVWQNSIRHNLSLNPFFVRVPRALDDPGRGHYW 132
            ..||.||.:|::|||.|.:||.|||||||...|.|:||||||||||..|::|||:.||||:|.||
Human    96 TFAINSSPKKKMTLSEIYQWICDNFPYYREAGSGWKNSIRHNLSLNKCFLKVPRSKDDPGKGSYW 160

  Fly   133 ALD------------------------PYAED-----------------LSIGETTGRLRRSNWQ 156
            |:|                        ||:.|                 |:|...|.::...|..
Human   161 AIDTNPKEDVLPTRPKKRARSVERASTPYSIDSDSLGMECIISGSASPTLAINTVTNKVTLYNTD 225

  Fly   157 QNTGARPK----------------------------VTGHPY--------QRMPYYG-------- 177
            |:....|:                            ||.||.        |:.|.|.        
Human   226 QDGSDSPRSSLNNSLSDQSLASVNLNSVGSVHSYTPVTSHPESVSQSLTPQQQPQYNLPERDKQL 290

  Fly   178 ----------------------------------------HGHGNGPYIKAHSAYFPIMDHQH-- 200
                                                    ..|.:..|  .||....:..|.|  
Human   291 LFSEYNFEDLSASFRSLYKSVFEQSLSQQGLMNIPSESSQQSHTSCTY--QHSPSSTVSTHPHSN 353

  Fly   201 ------------------HAAMVQHYQAMMHRYQMMPHPHHHQH---QHQHQ------HPHSHF- 237
                              ..|.|......||. |..|||.|..|   ||..:      ||..|. 
Human   354 QSSLSNSHGSGLNTTGSNSVAQVSLSHPQMHT-QPSPHPPHRPHGLPQHPQRSPHPAPHPQQHSQ 417

  Fly   238 IQQSKPLHIQEPYHHTRYH 256
            :|...|.| ..|:.|.::|
Human   418 LQSPHPQH-PSPHQHIQHH 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd19BNP_608369.1 FH 58..135 CDD:238016 47/76 (62%)
FOXJ3XP_005270689.1 Forkhead 86..163 CDD:278670 47/76 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 145 1.000 Inparanoid score I4438
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.870

Return to query results.
Submit another query.