Sequence 1: | NP_608369.1 | Gene: | fd19B / 33010 | FlyBaseID: | FBgn0031086 | Length: | 260 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_005270689.1 | Gene: | FOXJ3 / 22887 | HGNCID: | 29178 | Length: | 630 | Species: | Homo sapiens |
Alignment Length: | 409 | Identity: | 99/409 - (24%) |
---|---|---|---|
Similarity: | 140/409 - (34%) | Gaps: | 171/409 - (41%) |
- Green bases have known domain annotations that are detailed below.
Fly 15 SLLSVD-----------KKEESPISKHNSG-SSFSSCSSSSSNSSSDSMAAKSNAKPAFTYSALI 67
Fly 68 VMAIWSSSEKRLTLSGICKWIADNFPYYRTRKSVWQNSIRHNLSLNPFFVRVPRALDDPGRGHYW 132
Fly 133 ALD------------------------PYAED-----------------LSIGETTGRLRRSNWQ 156
Fly 157 QNTGARPK----------------------------VTGHPY--------QRMPYYG-------- 177
Fly 178 ----------------------------------------HGHGNGPYIKAHSAYFPIMDHQH-- 200
Fly 201 ------------------HAAMVQHYQAMMHRYQMMPHPHHHQH---QHQHQ------HPHSHF- 237
Fly 238 IQQSKPLHIQEPYHHTRYH 256 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
fd19B | NP_608369.1 | FH | 58..135 | CDD:238016 | 47/76 (62%) |
FOXJ3 | XP_005270689.1 | Forkhead | 86..163 | CDD:278670 | 47/76 (62%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG2294 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 145 | 1.000 | Inparanoid score | I4438 |
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1270467at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.870 |