DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd19B and fkh-10

DIOPT Version :9

Sequence 1:NP_608369.1 Gene:fd19B / 33010 FlyBaseID:FBgn0031086 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_492676.2 Gene:fkh-10 / 182874 WormBaseID:WBGene00001442 Length:194 Species:Caenorhabditis elegans


Alignment Length:144 Identity:57/144 - (39%)
Similarity:79/144 - (54%) Gaps:28/144 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 SSSSNSSSDS---MAAKS------------NAKPAFTYSALIVMAIWSSSEKRLTLSGICKWIAD 90
            |||::|..||   |...|            ..||..:|..||.|||.||.:|::.|:.:.:||.:
 Worm    10 SSSNHSLKDSPFPMIPLSFDTSIMSPTECQQPKPQHSYIGLIAMAILSSPQKKMVLAEVYEWIMN 74

  Fly    91 NFPYYRTRKSVWQNSIRHNLSLNPFFVRVPRALDDPGRGHYWALDP-YAEDLSIGETTGRLRRSN 154
            .:||:|:|.:.|:||||||||||..||:..||.:  |:|||||:.| ..:|...|:.  |.||  
 Worm    75 EYPYFRSRGAGWRNSIRHNLSLNDCFVKAGRAAN--GKGHYWAVHPACVKDFERGDF--RRRR-- 133

  Fly   155 WQQNTGARPKVTGH 168
                  |:.||..|
 Worm   134 ------AQRKVRRH 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd19BNP_608369.1 FH 58..135 CDD:238016 39/76 (51%)
fkh-10NP_492676.2 Forkhead 41..125 CDD:365978 41/85 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.