DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd19B and fkh-4

DIOPT Version :9

Sequence 1:NP_608369.1 Gene:fd19B / 33010 FlyBaseID:FBgn0031086 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_510238.2 Gene:fkh-4 / 181466 WormBaseID:WBGene00001436 Length:421 Species:Caenorhabditis elegans


Alignment Length:106 Identity:26/106 - (24%)
Similarity:51/106 - (48%) Gaps:4/106 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SIRSLLSVDKKEESPISKHNSG-SSFSSCSSSSSNSSSDSMAAKSNAKPAFTYSALIVMAIWSSS 75
            |.|...:..:.|::.:.:...| ..:...|.|....|:|....:   :|..:|.||..:|..::.
 Worm    74 STRKRKAPGQNEQATVKRRQIGIEKWRLPSRSVVQPSADISDLR---RPPISYVALCALACRNAP 135

  Fly    76 EKRLTLSGICKWIADNFPYYRTRKSVWQNSIRHNLSLNPFF 116
            :.::|.:|:..::..::.|||.....|:||:||.||....|
 Worm   136 DMKITPAGVYAFVLHHWRYYRYANENWKNSVRHQLSSKEHF 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd19BNP_608369.1 FH 58..135 CDD:238016 18/59 (31%)
fkh-4NP_510238.2 FH 118..206 CDD:214627 18/59 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.