DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd19B and fkh-2

DIOPT Version :9

Sequence 1:NP_608369.1 Gene:fd19B / 33010 FlyBaseID:FBgn0031086 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_508644.1 Gene:fkh-2 / 180663 WormBaseID:WBGene00001434 Length:270 Species:Caenorhabditis elegans


Alignment Length:236 Identity:93/236 - (39%)
Similarity:125/236 - (52%) Gaps:42/236 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DTTPIFQSSFSI--RSLLSVDKKEESPISKHNSGSSFSSCSSSSSNSSSDSMAAKS-NAKPAFTY 63
            ::|.|...|.||  ...:|.|...:..|....|.|:.|..|.|.|:|:|:.....| |.||.|:|
 Worm    34 ESTDISDPSTSIDTTDTMSTDYLHDESIDDERSESTLSKDSKSPSSSNSEEKTPSSPNDKPPFSY 98

  Fly    64 SALIVMAIWSSSEKRLTLSGICKWIADNFPYYRTRKSVWQNSIRHNLSLNPFFVRVPRALDDPGR 128
            :|||:|||..|.||||||:||.::|..|:|:||..|..||||||||||||..||:|||..||||:
 Worm    99 NALIMMAIKDSPEKRLTLAGIYEYIVTNYPFYRDNKQGWQNSIRHNLSLNKCFVKVPRNFDDPGK 163

  Fly   129 GHYWALDPYAED-LSIGETTGRLRRSNWQQNTGARPKVTGHPY------QRMPYYGHG------H 180
            |:||.||..||| :.||..||:|||   :.::.:|.::..:..      ...||:..|      |
 Worm   164 GNYWMLDATAEDEVFIGGATGKLRR---RPSSLSRARMDAYKQYGAAAANLFPYFSPGMPALPRH 225

  Fly   181 GNGPYIKAHSAYFPIMDHQHHAAMVQHYQAMMHRYQMMPHP 221
               ||:.|.:.:.|                    .||||.|
 Worm   226 ---PYLTAPNGFLP--------------------RQMMPIP 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd19BNP_608369.1 FH 58..135 CDD:238016 49/76 (64%)
fkh-2NP_508644.1 FH 93..170 CDD:238016 49/76 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160167387
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1751
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.