DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd19B and unc-130

DIOPT Version :9

Sequence 1:NP_608369.1 Gene:fd19B / 33010 FlyBaseID:FBgn0031086 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_496411.1 Gene:unc-130 / 174721 WormBaseID:WBGene00006853 Length:333 Species:Caenorhabditis elegans


Alignment Length:215 Identity:80/215 - (37%)
Similarity:116/215 - (53%) Gaps:19/215 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 RSLLSVDKKEES--PISKHNS-GSSFSSCSSSSSNSSSD-----------SMAA---KSNAKPAF 61
            |||.....::|.  |:.|.|. ..|.||.:.|||:.:.|           ||:.   .|:|||.:
 Worm    66 RSLGDEPTEDEDGVPVRKANKRNHSTSSAADSSSDDAKDDDDDDDSTSRKSMSGHRKSSHAKPPY 130

  Fly    62 TYSALIVMAIWSSSEKRLTLSGICKWIADNFPYYRTRKSVWQNSIRHNLSLNPFFVRVPRALDDP 126
            :|.|||.|:|.:|.||:||||.||::|.:.|.||:.:...||||||||||||..||:|.|...:|
 Worm   131 SYIALIAMSILNSPEKKLTLSEICEFIINKFEYYKEKFPAWQNSIRHNLSLNDCFVKVARGPGNP 195

  Fly   127 GRGHYWALDPYAEDLSIGETTGRLRRSNWQQNTGA-RPKVTGHPYQRMPYYGHGHGNGPYIKAHS 190
            |:|:||||||..||:....:..| ||..:::|:.. ...::.||....|:...|....|.:....
 Worm   196 GKGNYWALDPNCEDMFDNGSFLR-RRKRYKKNSDTYHEMMSHHPMPFPPFLPQGMPFPPRMMHPM 259

  Fly   191 AYFPIMDHQHHAAMVQHYQA 210
            |..|::.|..:...|.:..|
 Worm   260 ANIPMLGHPMNPRAVPNMPA 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd19BNP_608369.1 FH 58..135 CDD:238016 43/76 (57%)
unc-130NP_496411.1 COG5025 <126..330 CDD:227358 63/155 (41%)
Forkhead 127..212 CDD:365978 48/84 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.