DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd19B and Foxk1

DIOPT Version :9

Sequence 1:NP_608369.1 Gene:fd19B / 33010 FlyBaseID:FBgn0031086 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_951031.2 Gene:Foxk1 / 17425 MGIID:1347488 Length:719 Species:Mus musculus


Alignment Length:166 Identity:61/166 - (36%)
Similarity:93/166 - (56%) Gaps:27/166 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 IRSLLS--------VDKKEESPISKHNSGSS-----------------FSSCSSSSSNS-SSDSM 51
            :|||:|        :......|.|...:|||                 |::.::|...: :|...
Mouse   220 LRSLVSPIPSPTGTISVPNSCPASPRGAGSSSYRFVQNVTSDLQLAAEFAAKAASEQQADASGGD 284

  Fly    52 AAKSNAKPAFTYSALIVMAIWSSSEKRLTLSGICKWIADNFPYYRTRKSVWQNSIRHNLSLNPFF 116
            :.|..:||.::|:.|||.||.|:.:::||||||...|..::|||||....||||||||||||.:|
Mouse   285 SPKDESKPPYSYAQLIVQAISSAQDRQLTLSGIYAHITKHYPYYRTADKGWQNSIRHNLSLNRYF 349

  Fly   117 VRVPRALDDPGRGHYWALDPYAEDLSIGETTGRLRR 152
            ::|||:.::||:|.:|.:|| |.:..:.|...|.||
Mouse   350 IKVPRSQEEPGKGSFWRIDP-ASEAKLVEQAFRKRR 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd19BNP_608369.1 FH 58..135 CDD:238016 41/76 (54%)
Foxk1NP_951031.2 Interaction with SIN3A and SIN3B. /evidence=ECO:0000269|PubMed:10620510, ECO:0000269|PubMed:22476904 2..40
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 35..67
Required for interaction with FOXO4 and MEF2C. /evidence=ECO:0000269|PubMed:22956541 81..406 61/166 (37%)
FHA <88..190 CDD:224630
FHA 96..189 CDD:238017
Forkhead 291..377 CDD:278670 44/86 (51%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 399..443
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 665..719
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.