DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd19B and fkh-8

DIOPT Version :9

Sequence 1:NP_608369.1 Gene:fd19B / 33010 FlyBaseID:FBgn0031086 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001254107.1 Gene:fkh-8 / 174026 WormBaseID:WBGene00001440 Length:328 Species:Caenorhabditis elegans


Alignment Length:127 Identity:46/127 - (36%)
Similarity:66/127 - (51%) Gaps:25/127 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 KPAFTYSALIVMAIWSSSEKRLTLSGICKWIADNFPYYR-TRKSVWQNSIRHNLSLNPFFVRVPR 121
            ||.::||.||.:||..:.:|:.||:.|..:||.||.:|| .|.|.|:||||||||||..|.|:.:
 Worm    74 KPPYSYSQLIRLAIEDTPDKKCTLAEIYSFIAHNFQFYRENRNSSWKNSIRHNLSLNKQFSRIEK 138

  Fly   122 ALDDPGRGHYWALDPYAEDLSIGETTGRLRRSNWQQNTGARPKV-TGHPYQRMPYYGHGHGN 182
            . |...||.:..:||.|:                      :|:: .|.|.:..|.|.|.:.|
 Worm   139 T-DGDRRGWWVCVDPPAK----------------------KPRILKGSPVRVNPIYEHLYHN 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd19BNP_608369.1 FH 58..135 CDD:238016 36/77 (47%)
fkh-8NP_001254107.1 COG5025 30..>217 CDD:227358 46/127 (36%)
FH 74..156 CDD:214627 39/104 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.