DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd19B and Foxc2

DIOPT Version :9

Sequence 1:NP_608369.1 Gene:fd19B / 33010 FlyBaseID:FBgn0031086 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001095150.1 Gene:Foxc2 / 171356 RGDID:621703 Length:494 Species:Rattus norvegicus


Alignment Length:101 Identity:53/101 - (52%)
Similarity:68/101 - (67%) Gaps:2/101 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 AAKSNAKPAFTYSALIVMAIWSSSEKRLTLSGICKWIADNFPYYRTRKSVWQNSIRHNLSLNPFF 116
            |.|...||.::|.|||.|||.::.||::||:||.::|.|.||:||..|..||||||||||||..|
  Rat    65 APKDLVKPPYSYIALITMAIQNAPEKKITLNGIYQFIMDRFPFYRENKQGWQNSIRHNLSLNECF 129

  Fly   117 VRVPRALDDPGRGHYWALDPYAEDLSIGETTGRLRR 152
            |:|||....||:|.||.|||  :..::.|....|||
  Rat   130 VKVPRDDKKPGKGSYWTLDP--DSYNMFENGSFLRR 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd19BNP_608369.1 FH 58..135 CDD:238016 44/76 (58%)
Foxc2NP_001095150.1 FH_FOXC1 66..158 CDD:410818 49/93 (53%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 166..213
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 233..267
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 380..422
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.