DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd19B and Foxd1

DIOPT Version :9

Sequence 1:NP_608369.1 Gene:fd19B / 33010 FlyBaseID:FBgn0031086 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_599164.2 Gene:Foxd1 / 171299 RGDID:621712 Length:455 Species:Rattus norvegicus


Alignment Length:174 Identity:65/174 - (37%)
Similarity:87/174 - (50%) Gaps:34/174 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 GSSFSSCSSSSSNSSSDSMAAKSNAKPAFTYSALIVMAIWSSSEKRLTLSGICKWIADNFPYYRT 97
            |...:...:....||.:.:     .||.::|.|||.|||..|.:||||||.||::|:..|||||.
  Rat   110 GGVGAGAGTGGGGSSKNPL-----VKPPYSYIALITMAILQSPKKRLTLSEICEFISGRFPYYRE 169

  Fly    98 RKSVWQNSIRHNLSLNPFFVRVPRALDDPGRGHYWALDPYAEDL-SIGETTGRLRRSNWQQNTGA 161
            :...||||||||||||..||::||...:||:|:||.|||.:.|: ..|....|.:|         
  Rat   170 KFPAWQNSIRHNLSLNDCFVKIPREPGNPGKGNYWTLDPESADMFDNGSFLRRRKR--------- 225

  Fly   162 RPKVTGHPYQRMPYYG-HG-------HGNGPYIKA---HSAYFP 194
                    ::|.|... |.       .|.||...|   .:|.||
  Rat   226 --------FKRQPLLAPHAAAEALLLRGAGPAASAGDPGAALFP 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd19BNP_608369.1 FH 58..135 CDD:238016 45/76 (59%)
Foxd1NP_599164.2 FH_FOXD1_D2-like 130..228 CDD:410820 52/114 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.