DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd19B and Foxa3

DIOPT Version :10

Sequence 1:NP_608369.1 Gene:fd19B / 33010 FlyBaseID:FBgn0031086 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_032286.1 Gene:Foxa3 / 15377 MGIID:1347477 Length:353 Species:Mus musculus


Alignment Length:123 Identity:54/123 - (43%)
Similarity:68/123 - (55%) Gaps:19/123 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 GSSFSSCSSSSSNSSSDS--------------MA-----AKSNAKPAFTYSALIVMAIWSSSEKR 78
            |.:|.|..:..|...|.|              ||     ..::|||.::|.:||.|||..:..|.
Mouse    75 GPTFPSLGTGGSTGGSASGYVAPGPGLVHGKEMAKGYRRPLAHAKPPYSYISLITMAIQQAPGKM 139

  Fly    79 LTLSGICKWIADNFPYYRTRKSVWQNSIRHNLSLNPFFVRVPRALDDPGRGHYWALDP 136
            ||||.|.:||.|.|||||..:..|||||||:||.|..||:|.|:.|.||:|.||||.|
Mouse   140 LTLSEIYQWIMDLFPYYRENQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSYWALHP 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd19BNP_608369.1 Forkhead 58..140 CDD:459732 45/79 (57%)
Foxa3NP_032286.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 52..83 3/7 (43%)
FH_FOXA3 117..218 CDD:410814 46/81 (57%)
COG5025 <118..323 CDD:227358 46/80 (58%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 219..287
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.