DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd19B and Foxa2

DIOPT Version :9

Sequence 1:NP_608369.1 Gene:fd19B / 33010 FlyBaseID:FBgn0031086 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001277994.1 Gene:Foxa2 / 15376 MGIID:1347476 Length:465 Species:Mus musculus


Alignment Length:289 Identity:80/289 - (27%)
Similarity:117/289 - (40%) Gaps:70/289 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 SPISKHNSGS-SFSSCSSSSSNSSSDSMAAKSNAKPAFTYSALIVMAIWSSSEKRLTLSGICKWI 88
            :|.:..||.| .:.....|.:........:.::|||.::|.:||.|||..|..|.||||.|.:||
Mouse   131 APYANMNSMSPMYGQAGLSRARDPKTYRRSYTHAKPPYSYISLITMAIQQSPNKMLTLSEIYQWI 195

  Fly    89 ADNFPYYRTRKSVWQNSIRHNLSLNPFFVRVPRALDDPGRGHYWALDPYA--------------- 138
            .|.||:||..:..|||||||:||.|..|::|||:.|.||:|.:|.|.|.:               
Mouse   196 MDLFPFYRQNQQRWQNSIRHSLSFNDCFLKVPRSPDKPGKGSFWTLHPDSGNMFENGCYLRRQKR 260

  Fly   139 ----EDLSIGETTGRLRRSNWQQNTGARPKVTGHPYQRMPYYGHGHGNGPYIKA-----HSAYFP 194
                :.|::.|..|       ..::|.:....|....: ...|...|:.....|     ||:..|
Mouse   261 FKCEKQLALKEAAG-------AASSGGKKTAPGSQASQ-AQLGEAAGSASETPAGTESPHSSASP 317

  Fly   195 IMDHQHHA-------------------AMVQHYQAMMHRYQMMPHPHH-------H---QHQHQH 230
            ..:|:...                   :..|..||..|   ::..|||       |   :|.:..
Mouse   318 CQEHKRGGLSELKGAPASALSPPEPAPSPGQQQQAAAH---LLGPPHHPGLPPEAHLKPEHHYAF 379

  Fly   231 QHPHSHFIQQSKPLHIQEPYHHTRYHLHQ 259
            .||.|     ...|...|..||..:|.||
Mouse   380 NHPFS-----INNLMSSEQQHHHSHHHHQ 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd19BNP_608369.1 FH 58..135 CDD:238016 41/76 (54%)
Foxa2NP_001277994.1 Forkhead_N 23..164 CDD:254796 5/32 (16%)
FH 165..253 CDD:214627 43/87 (49%)
DUF4799 <224..319 CDD:292674 21/102 (21%)
HNF_C 381..454 CDD:286443 10/28 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.