DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd19B and Foxd1

DIOPT Version :10

Sequence 1:NP_608369.1 Gene:fd19B / 33010 FlyBaseID:FBgn0031086 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_032268.2 Gene:Foxd1 / 15229 MGIID:1347463 Length:456 Species:Mus musculus


Alignment Length:110 Identity:52/110 - (47%)
Similarity:71/110 - (64%) Gaps:0/110 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 SGSSFSSCSSSSSNSSSDSMAAKSNAKPAFTYSALIVMAIWSSSEKRLTLSGICKWIADNFPYYR 96
            ||:.....:...:.:.:...|.....||.::|.|||.|||..|.:||||||.||::|:..|||||
Mouse   104 SGAGAGGGAGGGTGAGTGGGAKNPLVKPPYSYIALITMAILQSPKKRLTLSEICEFISSRFPYYR 168

  Fly    97 TRKSVWQNSIRHNLSLNPFFVRVPRALDDPGRGHYWALDPYAEDL 141
            .:...||||||||||||..||::||...:||:|:||.|||.:.|:
Mouse   169 EKFPAWQNSIRHNLSLNDCFVKIPREPGNPGKGNYWTLDPESADM 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd19BNP_608369.1 Forkhead 58..140 CDD:459732 48/81 (59%)
Foxd1NP_032268.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..104 52/110 (47%)
FH_FOXD1_D2-like 130..228 CDD:410820 49/84 (58%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 303..322
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 381..401
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.