DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd19B and Foxg1

DIOPT Version :9

Sequence 1:NP_608369.1 Gene:fd19B / 33010 FlyBaseID:FBgn0031086 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001153584.1 Gene:Foxg1 / 15228 MGIID:1347464 Length:481 Species:Mus musculus


Alignment Length:253 Identity:89/253 - (35%)
Similarity:122/253 - (48%) Gaps:37/253 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 DKKEESPISKHNSGSSFSSCSSSSSNSSSDSMAAKSNA---KPAFTYSALIVMAIWSSSEKRLTL 81
            |:||:...:   .|...........:........|.|.   ||.|:|:|||:|||..|.||||||
Mouse   135 DEKEKGAGA---GGEEKKGAGEGGKDGEGGKEGDKKNGKYEKPPFSYNALIMMAIRQSPEKRLTL 196

  Fly    82 SGICKWIADNFPYYRTRKSVWQNSIRHNLSLNPFFVRVPRALDDPGRGHYWALDPYAEDLSIGET 146
            :||.::|..||||||..|..||||||||||||..||:|||..||||:|:||.|||.::|:.||.|
Mouse   197 NGIYEFIMKNFPYYRENKQGWQNSIRHNLSLNKCFVKVPRHYDDPGKGNYWMLDPSSDDVFIGGT 261

  Fly   147 TGRLRRSNWQQNT------GARPKVTGHPYQRMPYYGHGHGNGPYIKAHSAYFPIMD----HQHH 201
            ||:|||.:.....      |||...||..:..              :|.|.|:|:..    |...
Mouse   262 TGKLRRRSTTSRAKLAFKRGARLTSTGLTFMD--------------RAGSLYWPMSPFLSLHHPR 312

  Fly   202 AAMVQHYQAMMHRYQMMPHPH-----HHQHQHQHQHPHSHFIQQSKPLHIQEPY--HH 252
            |:....|......|...|.|:     .:...:.|....::.:...:.::.:.||  ||
Mouse   313 ASSTLSYNGTTSAYPSHPMPYSSVLTQNSLGNNHSFSTANGLSVDRLVNGEIPYATHH 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd19BNP_608369.1 FH 58..135 CDD:238016 51/76 (67%)
Foxg1NP_001153584.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 31..173 6/40 (15%)
FH 173..261 CDD:214627 57/87 (66%)
Required for interaction with TLE6. /evidence=ECO:0000269|PubMed:16314515 241..336 32/108 (30%)
Interaction with KDM5B. /evidence=ECO:0000250 375..398
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 419..447
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1751
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.