DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd19B and Foxf1

DIOPT Version :9

Sequence 1:NP_608369.1 Gene:fd19B / 33010 FlyBaseID:FBgn0031086 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_034556.2 Gene:Foxf1 / 15227 MGIID:1347470 Length:378 Species:Mus musculus


Alignment Length:264 Identity:81/264 - (30%)
Similarity:123/264 - (46%) Gaps:35/264 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LSVDKKEESPISKHNSGSSFSSCSSSSSNSSSDSMAAKSNA------KPAFTYSALIVMAIWSSS 75
            :|...|::.|......|...:...:....::..:.|.|:||      ||.::|.|||||||.||.
Mouse     1 MSAPDKQQPPHGGGTGGGGGAGGQAMDPAAAGPTKAKKTNAGVRRPEKPPYSYIALIVMAIQSSP 65

  Fly    76 EKRLTLSGICKWIADNFPYYRTRKSVWQNSIRHNLSLNPFFVRVPRALDDPGRGHYWALDPYAED 140
            .||||||.|.:::...||::|.....|:||:|||||||..|:::|:.|..||:||||.:|| |.:
Mouse    66 SKRLTLSEIYQFLQARFPFFRGAYQGWKNSVRHNLSLNECFIKLPKGLGRPGKGHYWTIDP-ASE 129

  Fly   141 LSIGETTGRLRRSNWQQNTGA-RP---KVTGHPYQRMP-YYG-HGHGN---GPYIKAHSAYFPIM 196
            ....|.:.|.|...:::...| :|   .|.|..:..:| .|| .|.|.   .|...|......:|
Mouse   130 FMFEEGSFRRRPRGFRRKCQALKPVYSMVNGLGFNHLPDTYGFQGSGGLSCAPNSLALEGGLGMM 194

  Fly   197 DHQHHAAMVQHYQAMMHRYQMMPH-PHHHQHQHQ--------HQHPHSHFIQQSKPL------HI 246
             :.|.|..|.......|   .:|| |.:..|.:.        .::||......:.||      .:
Mouse   195 -NGHLAGNVDGMALPSH---SVPHLPSNGGHSYMGGCGGSAAGEYPHHDSSVPASPLLPAGAGGV 255

  Fly   247 QEPY 250
            .||:
Mouse   256 MEPH 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd19BNP_608369.1 FH 58..135 CDD:238016 41/76 (54%)
Foxf1NP_034556.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..45 8/43 (19%)
Forkhead 48..133 CDD:306709 44/85 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.