DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd19B and Foxq1

DIOPT Version :9

Sequence 1:NP_608369.1 Gene:fd19B / 33010 FlyBaseID:FBgn0031086 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_032265.3 Gene:Foxq1 / 15220 MGIID:1298228 Length:400 Species:Mus musculus


Alignment Length:116 Identity:47/116 - (40%)
Similarity:67/116 - (57%) Gaps:13/116 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 KPAFTYSALIVMAIWSSSEKRLTLSGICKWIADNFPYYRTRKSVWQNSIRHNLSLNPFFVRVPRA 122
            ||.::|.|||.|||..|:..||||:.|.:::...||::|...:.|:||:|||||||..||:|   
Mouse   115 KPPYSYIALIAMAIRDSAGGRLTLAEINEYLMGKFPFFRGSYTGWRNSVRHNLSLNDCFVKV--- 176

  Fly   123 LDDP----GRGHYWALDPYAEDLSIGETTGRLRRSNWQQNT-----GARPK 164
            |.||    |:.:||.|:|.:| .:..:...|.||......|     |.||:
Mouse   177 LRDPSRPWGKDNYWMLNPNSE-YTFADGVFRRRRKRLSHRTTVSASGLRPE 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd19BNP_608369.1 FH 58..135 CDD:238016 37/80 (46%)
Foxq1NP_032265.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..112
FH 115..193 CDD:238016 37/80 (46%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 213..264 4/14 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.