DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd19B and Foxl1

DIOPT Version :10

Sequence 1:NP_608369.1 Gene:fd19B / 33010 FlyBaseID:FBgn0031086 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_032050.2 Gene:Foxl1 / 14241 MGIID:1347469 Length:336 Species:Mus musculus


Alignment Length:113 Identity:53/113 - (46%)
Similarity:67/113 - (59%) Gaps:10/113 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 KPAFTYSALIVMAIWSSSEKRLTLSGICKWIADNFPYYRTRKSVWQNSIRHNLSLNPFFVRVPRA 122
            ||.::|.|||.|||..:.|:|:||:||.::|.|.||:|...:..||||||||||||..||:|||.
Mouse    49 KPPYSYIALIAMAIQDAPEQRVTLNGIYQFIMDRFPFYHDNRQGWQNSIRHNLSLNECFVKVPRE 113

  Fly   123 LDDPGRGHYWALDPYAEDLSIGETTGRLRRSNWQQNTGARPK-VTGHP 169
            ...||:|.||.|||...|:.   ..|..||..      .:|| ..|.|
Mouse   114 KGRPGKGSYWTLDPRCLDMF---ENGNYRRRK------RKPKPAAGSP 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd19BNP_608369.1 Forkhead 58..140 CDD:459732 45/81 (56%)
Foxl1NP_032050.2 FH_FOXL1 47..144 CDD:410801 49/103 (48%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 140..214 5/19 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 227..252
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.