DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd19B and Foxb2

DIOPT Version :9

Sequence 1:NP_608369.1 Gene:fd19B / 33010 FlyBaseID:FBgn0031086 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_032049.1 Gene:Foxb2 / 14240 MGIID:1347468 Length:428 Species:Mus musculus


Alignment Length:210 Identity:75/210 - (35%)
Similarity:94/210 - (44%) Gaps:42/210 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 SNAKPAFTYSALIVMAIWSSSEKRLTLSGICKWIADNFPYYRTRKSVWQNSIRHNLSLNPFFVRV 119
            |:.||.::|.:|..|||..|:||.|.||.|.|:|.:.|||||.....||||:|||||.|..|:::
Mouse    10 SDQKPPYSYISLTAMAIQHSAEKMLPLSDIYKFIMERFPYYREHTQRWQNSLRHNLSFNDCFIKI 74

  Fly   120 PRALDDPGRGHYWALDPYAEDLSIGETTGRLRRSNWQQNTGARPKVT----GHPYQRMPYYGHGH 180
            ||..|.||:|.:|||.|...|:.  |....|||..       |.||.    .|.:........|.
Mouse    75 PRRPDQPGKGSFWALHPDCGDMF--ENGSFLRRRK-------RFKVLRADHAHLHSGSSKGAPGT 130

  Fly   181 GNGPYIKAHSAYFPIMDHQHHAAMVQHYQAMMHRYQMMPHPHHHQHQHQHQHPHSHFIQQSKPLH 245
            |.|.::..|        |.|||                 |.|||.|.|...|.|.|...|..|  
Mouse   131 GPGGHLHPH--------HPHHA-----------------HHHHHHHHHAAHHHHHHHPPQPPP-- 168

  Fly   246 IQEPYHHTRYHLHQE 260
              .|..|...:.||:
Mouse   169 --PPPPHMVPYFHQQ 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd19BNP_608369.1 FH 58..135 CDD:238016 40/76 (53%)
Foxb2NP_032049.1 FH 13..101 CDD:214627 44/89 (49%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 118..217 24/93 (26%)
E_Pc_C <342..>406 CDD:284226
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 408..428
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.