DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd19B and Foxs1

DIOPT Version :9

Sequence 1:NP_608369.1 Gene:fd19B / 33010 FlyBaseID:FBgn0031086 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_034356.1 Gene:Foxs1 / 14239 MGIID:95546 Length:329 Species:Mus musculus


Alignment Length:159 Identity:64/159 - (40%)
Similarity:83/159 - (52%) Gaps:30/159 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 SSDSMAAKSN-AKPAFTYSALIVMAIWSSSEKRLTLSGICKWIADNFPYYRTRKSVWQNSIRHNL 110
            |.:|:|..:. .||.::|.|||.|||.||..:|.|||||.::|...|.:||..:..|||||||||
Mouse     6 SPESLAPSAEPTKPPYSYIALIAMAIQSSPGQRATLSGIYRYIMGRFAFYRHNRPGWQNSIRHNL 70

  Fly   111 SLNPFFVRVPRALDDPGRGHYWALDPYAEDL-SIGETTGRLRRSNWQQNTGARPKVTGHPYQRMP 174
            |||..||:|||....||:|.||.|||...|: ..|....|.||  :.:.|||:..          
Mouse    71 SLNECFVKVPRDDRKPGKGSYWTLDPDCHDMFQHGSFLRRRRR--FTKRTGAQGT---------- 123

  Fly   175 YYGHGHGNGPYIKAHSAYFPIMDHQHHAA 203
                   .|| :|        :||:.|.|
Mouse   124 -------KGP-VK--------IDHRPHRA 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd19BNP_608369.1 FH 58..135 CDD:238016 43/76 (57%)
Foxs1NP_034356.1 Forkhead 18..103 CDD:278670 47/84 (56%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 117..150 10/46 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 174..213
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.