DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd19B and Foxc2

DIOPT Version :9

Sequence 1:NP_608369.1 Gene:fd19B / 33010 FlyBaseID:FBgn0031086 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_038547.2 Gene:Foxc2 / 14234 MGIID:1347481 Length:494 Species:Mus musculus


Alignment Length:101 Identity:53/101 - (52%)
Similarity:68/101 - (67%) Gaps:2/101 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 AAKSNAKPAFTYSALIVMAIWSSSEKRLTLSGICKWIADNFPYYRTRKSVWQNSIRHNLSLNPFF 116
            |.|...||.::|.|||.|||.::.||::||:||.::|.|.||:||..|..||||||||||||..|
Mouse    65 APKDLVKPPYSYIALITMAIQNAPEKKITLNGIYQFIMDRFPFYRENKQGWQNSIRHNLSLNECF 129

  Fly   117 VRVPRALDDPGRGHYWALDPYAEDLSIGETTGRLRR 152
            |:|||....||:|.||.|||  :..::.|....|||
Mouse   130 VKVPRDDKKPGKGSYWTLDP--DSYNMFENGSFLRR 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd19BNP_608369.1 FH 58..135 CDD:238016 44/76 (58%)
Foxc2NP_038547.2 FH 71..159 CDD:214627 48/89 (54%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 166..213
EBP50_C 167..>257 CDD:286142
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 233..267
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 381..422
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.010

Return to query results.
Submit another query.