DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd19B and foxb2

DIOPT Version :9

Sequence 1:NP_608369.1 Gene:fd19B / 33010 FlyBaseID:FBgn0031086 Length:260 Species:Drosophila melanogaster
Sequence 2:XP_004921500.2 Gene:foxb2 / 101730239 XenbaseID:XB-GENE-1021718 Length:317 Species:Xenopus tropicalis


Alignment Length:240 Identity:72/240 - (30%)
Similarity:99/240 - (41%) Gaps:52/240 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 SNAKPAFTYSALIVMAIWSSSEKRLTLSGICKWIADNFPYYRTRKSVWQNSIRHNLSLNPFFVRV 119
            |..||.::|.:|..|||.||.||.|.||.|.|:|.|.|||||.....||||:|||||.|..|:::
 Frog    10 SEQKPPYSYISLTAMAIQSSQEKMLPLSDIYKFIMDRFPYYRENTQRWQNSLRHNLSFNDCFIKI 74

  Fly   120 PRALDDPGRGHYWALDPYAEDLSIGETTGRLRRSNWQQNTGARPKV------TGHPYQRMPYYGH 178
            ||..|.||:|.:|||.|...|:.  |....|||..       |.||      ....:|.:.|:.|
 Frog    75 PRRPDQPGKGSFWALHPDCGDMF--ENGSFLRRRK-------RFKVVRAEHLASKSHQMIHYFHH 130

  Fly   179 GHGN----------------------GPYIKAHSAYFPIMDHQHHAAMV----QHYQ-------- 209
            .|..                      .||..|:.:.......:|..|:.    :.|:        
 Frog   131 QHNQTKLGIPASEGSPVPSLGRLPHFQPYNIANMSGSQTSGFKHPFAIENIIGRDYKGVMTGGLP 195

  Fly   210 --AMMHRYQMMPHPHHHQHQHQHQHPHSHFIQQSKPLHIQEPYHH 252
              :||| :...|.|....:......||...:.....:.:.:.|.|
 Frog   196 LASMMH-HLGYPVPSQLSNMVSSMWPHVGMMDSMASMTVPQEYGH 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd19BNP_608369.1 FH 58..135 CDD:238016 42/76 (55%)
foxb2XP_004921500.2 FH_FOXB2 1..110 CDD:410817 51/108 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.