Sequence 1: | NP_608369.1 | Gene: | fd19B / 33010 | FlyBaseID: | FBgn0031086 | Length: | 260 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_004921500.2 | Gene: | foxb2 / 101730239 | XenbaseID: | XB-GENE-1021718 | Length: | 317 | Species: | Xenopus tropicalis |
Alignment Length: | 240 | Identity: | 72/240 - (30%) |
---|---|---|---|
Similarity: | 99/240 - (41%) | Gaps: | 52/240 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 55 SNAKPAFTYSALIVMAIWSSSEKRLTLSGICKWIADNFPYYRTRKSVWQNSIRHNLSLNPFFVRV 119
Fly 120 PRALDDPGRGHYWALDPYAEDLSIGETTGRLRRSNWQQNTGARPKV------TGHPYQRMPYYGH 178
Fly 179 GHGN----------------------GPYIKAHSAYFPIMDHQHHAAMV----QHYQ-------- 209
Fly 210 --AMMHRYQMMPHPHHHQHQHQHQHPHSHFIQQSKPLHIQEPYHH 252 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
fd19B | NP_608369.1 | FH | 58..135 | CDD:238016 | 42/76 (55%) |
foxb2 | XP_004921500.2 | FH_FOXB2 | 1..110 | CDD:410817 | 51/108 (47%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000010 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.000 |