DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd19B and foxd2

DIOPT Version :9

Sequence 1:NP_608369.1 Gene:fd19B / 33010 FlyBaseID:FBgn0031086 Length:260 Species:Drosophila melanogaster
Sequence 2:XP_002931458.1 Gene:foxd2 / 100495241 XenbaseID:XB-GENE-479818 Length:348 Species:Xenopus tropicalis


Alignment Length:231 Identity:80/231 - (34%)
Similarity:110/231 - (47%) Gaps:41/231 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 DKKEESPISKHNSGSSFSSCSSSSSNSSSDSMAAKSNAKPAFTYSALIVMAIWSSSEKRLTLSGI 84
            |..:..|.:.....:|....|.|.||..::.....:..||.::|.|||.|||..|.:||||||.|
 Frog    40 DSDDNGPRTHRGDPASPDLSSGSESNQRAEKPPKNALVKPPYSYIALITMAILQSPKKRLTLSEI 104

  Fly    85 CKWIADNFPYYRTRKSVWQNSIRHNLSLNPFFVRVPRALDDPGRGHYWALDPYAEDL-SIGETTG 148
            |::|::.|||||.:...||||||||||||..||::||...:||:|:||.|||.:.|: ..|....
 Frog   105 CEFISNRFPYYREKFPAWQNSIRHNLSLNDCFVKIPREPGNPGKGNYWTLDPESADMFDNGSFLR 169

  Fly   149 RLRRSNWQQNTGARPKVTGHPYQRMPYYGHGHGNGPYIKAHSAYFPIMDHQHHAAMVQHYQAMMH 213
            |.:|...||:.    ::...|...||   ...|.|||     .|       ::...:|:|     
 Frog   170 RRKRFKRQQSN----EILRDPSSFMP---AAFGYGPY-----GY-------NYGLQLQNY----- 210

  Fly   214 RYQMMPHPHHHQHQHQHQHPHSHFIQQSKPLHIQEP 249
                          |||.|..:.|..|  |.|...|
 Frog   211 --------------HQHHHTGATFSFQ--PTHCPLP 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd19BNP_608369.1 FH 58..135 CDD:238016 45/76 (59%)
foxd2XP_002931458.1 Forkhead 78..163 CDD:365978 49/84 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.