DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd19B and foxe3

DIOPT Version :9

Sequence 1:NP_608369.1 Gene:fd19B / 33010 FlyBaseID:FBgn0031086 Length:260 Species:Drosophila melanogaster
Sequence 2:XP_002931457.1 Gene:foxe3 / 100495102 XenbaseID:XB-GENE-480592 Length:398 Species:Xenopus tropicalis


Alignment Length:271 Identity:91/271 - (33%)
Similarity:118/271 - (43%) Gaps:62/271 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 SKHNSGSSFSSCSSSSSNSSSDSMAAK---------------------------------SNAKP 59
            |:|:...:.|...||.|..|..|:..|                                 ...||
 Frog    19 SQHSPTEAASPIPSSPSMDSPGSVRVKCEPKGTCSPEEGVNGLPDEHNQASGGRRRKRPIQRGKP 83

  Fly    60 AFTYSALIVMAIWSSSEKRLTLSGICKWIADNFPYYRTRKSVWQNSIRHNLSLNPFFVRVPRALD 124
            .::|.|||.|||.:|.|::|||.||.|:|.:.||:||.....|||||||||:||..||::||...
 Frog    84 PYSYIALIAMAIANSPERKLTLGGIYKFIMERFPFYRENSKKWQNSIRHNLTLNDCFVKIPREPG 148

  Fly   125 DPGRGHYWALDPYAEDL----SIGETTGRLRRSN------WQQNTGARPKVTGHPYQRMPYYGHG 179
            .||:|:||.|||.|||:    |......|.:|::      :.||:.|   .|..|..|..|    
 Frog   149 HPGKGNYWTLDPAAEDMFDNGSFLRRRKRFKRTDLTTYPGYMQNSSA---FTPTPAGRASY---- 206

  Fly   180 HGNGPYIKAHSAYFPIMDHQHHAAMVQHYQAMMHRYQMMPHPHHHQHQHQHQHPHSHFIQQS--K 242
             ....|....|.|.|.:...||.|||.|||         |.....|.||:.....|...|||  :
 Frog   207 -PTSIYSSVGSGYNPQIHQTHHPAMVHHYQ---------PPGGAGQGQHRMFSIDSLINQQSVMQ 261

  Fly   243 PLHIQEPYHHT 253
            |....|..||:
 Frog   262 PSPGAELTHHS 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd19BNP_608369.1 FH 58..135 CDD:238016 42/76 (55%)
foxe3XP_002931457.1 FH 82..170 CDD:214627 48/87 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.