DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd19B and foxm1

DIOPT Version :9

Sequence 1:NP_608369.1 Gene:fd19B / 33010 FlyBaseID:FBgn0031086 Length:260 Species:Drosophila melanogaster
Sequence 2:XP_002941428.1 Gene:foxm1 / 100492241 XenbaseID:XB-GENE-854081 Length:754 Species:Xenopus tropicalis


Alignment Length:133 Identity:48/133 - (36%)
Similarity:62/133 - (46%) Gaps:8/133 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 SFSIRSLLSVDKKEESPISKHNSGSSFSSCSSSSSNSS---SDSMAAKSNAKPAFTYSALIVMAI 71
            :.|..||.....|||....|.|.... :.|......|.   ..........:|.::|.|||..||
 Frog   212 NMSSESLGQYSIKEEEHEDKENQIPE-TGCPKMEDESQLFPDPQWPVSVTERPPYSYMALIQFAI 275

  Fly    72 WSSSEKRLTLSGICKWIADNFPYYR-TRKSVWQNSIRHNLSLNPFFVRVPRALDDPGRGHYWALD 135
            .|:..||:||..|..||.|:|||:: ..|..|:|||||||||:..|||...|   ..:..||.:.
 Frog   276 NSTPRKRMTLKDIYTWIEDHFPYFKHVAKPGWKNSIRHNLSLHDMFVRESEA---NNKVSYWTIH 337

  Fly   136 PYA 138
            |.|
 Frog   338 PQA 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd19BNP_608369.1 FH 58..135 CDD:238016 36/77 (47%)
foxm1XP_002941428.1 FH 262..337 CDD:238016 36/77 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.