DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd19B and foxl3-ot1

DIOPT Version :9

Sequence 1:NP_608369.1 Gene:fd19B / 33010 FlyBaseID:FBgn0031086 Length:260 Species:Drosophila melanogaster
Sequence 2:XP_002932017.1 Gene:foxl3-ot1 / 100488925 XenbaseID:XB-GENE-6035521 Length:246 Species:Xenopus tropicalis


Alignment Length:130 Identity:53/130 - (40%)
Similarity:73/130 - (56%) Gaps:14/130 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 GSSFSSCSSSSSNSSSDSMAAKSNAKPAFTYSALIVMAIWSSSEKRLTLSGICKWIADNFPYYRT 97
            |..:.:|||...         |...:||::|.|||.|||..|.:.::|||||..:|...|||||:
 Frog    16 GDDYPACSSDEE---------KKFNRPAYSYIALIAMAIQQSPDSKVTLSGIYDFIMKKFPYYRS 71

  Fly    98 RKSVWQNSIRHNLSLNPFFVRVPRAL-DDPGRGHYWALDPYAEDL----SIGETTGRLRRSNWQQ 157
            .:..||||||||||||..||:|||.. ::.|:|:||:.....|.:    ..|....|.||.|.::
 Frog    72 NQRAWQNSIRHNLSLNSCFVKVPRTEGNEKGKGNYWSFASGCESMLDLFENGNYKRRRRRRNMKK 136

  Fly   158  157
             Frog   137  136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd19BNP_608369.1 FH 58..135 CDD:238016 42/77 (55%)
foxl3-ot1XP_002932017.1 Forkhead 32..118 CDD:365978 43/85 (51%)
COG5025 33..>224 CDD:227358 48/104 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.