DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd19B and foxd4l1.2

DIOPT Version :9

Sequence 1:NP_608369.1 Gene:fd19B / 33010 FlyBaseID:FBgn0031086 Length:260 Species:Drosophila melanogaster
Sequence 2:XP_002935635.1 Gene:foxd4l1.2 / 100485983 XenbaseID:XB-GENE-876578 Length:338 Species:Xenopus tropicalis


Alignment Length:288 Identity:86/288 - (29%)
Similarity:129/288 - (44%) Gaps:61/288 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LLSVDKKEESPISKHNSGSSFSSCSSSSSNSSSDSMAAKSNAKPAFTYSALIVMAIWSSSEKRLT 80
            :||..|...:..|.|:|.......|..|.:::.||.|:::..||.::|.|||.|||..|..::||
 Frog    55 VLSPSKLSGTENSCHSSEEKEGGTSKDSLHTTPDSKASRAFLKPPYSYIALITMAIVQSPYRKLT 119

  Fly    81 LSGICKWIADNFPYYRTRKSVWQNSIRHNLSLNPFFVRVPRALDDPGRGHYWALDPYAEDLSIGE 145
            |||||.:|:..||||:.:...||||||||||||..|:::||...:||:|:||.|||.::|:.  :
 Frog   120 LSGICDFISSKFPYYKDKFPAWQNSIRHNLSLNDCFIKIPREPGNPGKGNYWTLDPASKDMF--D 182

  Fly   146 TTGRLRRSNWQQNTGARPKVTGHPYQRMP----YYGHGHGNGPYIKAHSAYFPI--MDHQHHAAM 204
            ....|||         |.:...|..:.:.    .|...|...|| .|.....|:  |....:.||
 Frog   183 NGSFLRR---------RKRFKRHHQELIKDGFLMYNPLHYITPY-SAPQTQTPVICMAIPQNLAM 237

  Fly   205 VQHYQAMMHRYQMMPHP------------HHHQHQH------------QHQHP------------ 233
            ..|.....|:.: :|.|            :||...|            :.:.|            
 Frog   238 PNHLAPYPHKIK-VPCPDQGVNRVFKAQDNHHTASHHKCSFSIENIMGEPKEPEKSLKSFNQNWN 301

  Fly   234 HSHFIQQSKPL------HIQEPYHHTRY 255
            ::|.:|.|...      ||...:..|:|
 Frog   302 YNHLLQSSSACLLPSGSHITSAHQGTQY 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd19BNP_608369.1 FH 58..135 CDD:238016 42/76 (55%)
foxd4l1.2XP_002935635.1 Forkhead 97..182 CDD:365978 46/86 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.