DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd19B and foxk2

DIOPT Version :9

Sequence 1:NP_608369.1 Gene:fd19B / 33010 FlyBaseID:FBgn0031086 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001135634.1 Gene:foxk2 / 100216193 XenbaseID:XB-GENE-483520 Length:645 Species:Xenopus tropicalis


Alignment Length:262 Identity:76/262 - (29%)
Similarity:117/262 - (44%) Gaps:63/262 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 SVDKKEESPISKHNSGSS-------------FSSCSSSSSNSSSDSMAAKSNAKPAFTYSALIVM 69
            ::......|.|...:|||             ..:..|.:...:|...:.|.::||.::|:.|||.
 Frog   166 TISAANSCPSSPRGAGSSGFKLGRVIPPDLIAEAAQSENDKDASGGDSPKDDSKPPYSYAQLIVQ 230

  Fly    70 AIWSSSEKRLTLSGICKWIADNFPYYRTRKSVWQNSIRHNLSLNPFFVRVPRALDDPGRGHYWAL 134
            ||..:.:|:|||:||...|..|:|||||....||||||||||||.:|::|||:.::||:|.:|.:
 Frog   231 AITMAPDKQLTLNGIYTHITKNYPYYRTADKGWQNSIRHNLSLNRYFIKVPRSQEEPGKGSFWRI 295

  Fly   135 DPYAEDLSIGETTGRLRRSNWQQNTGARPKVTGHPYQRMPYYGHGHGNGPYIKAHSAYFPIMDHQ 199
            || |.:..:.|...|.|          ||:  |.|..|.|.       ||.....:...|     
 Frog   296 DP-ASESKLVEQAFRKR----------RPR--GVPCFRTPL-------GPLSSRSAPASP----- 335

  Fly   200 HHAAMVQHYQAMMHRYQ----------MMPHPHHHQHQHQHQHPHSHFIQQSK--------PLHI 246
            :||.::..:.:.:...:          |.|.|...|       |....||:::        ||..
 Frog   336 NHAGVLSAHSSGLQTPESLSREGSPIPMEPEPSAIQ-------PKLAVIQEARFAQSAPGSPLSS 393

  Fly   247 QE 248
            |:
 Frog   394 QQ 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd19BNP_608369.1 FH 58..135 CDD:238016 41/76 (54%)
foxk2NP_001135634.1 FHA 10..117 CDD:238017
Forkhead 218..304 CDD:365978 44/86 (51%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.