DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd19B and foxl2b

DIOPT Version :9

Sequence 1:NP_608369.1 Gene:fd19B / 33010 FlyBaseID:FBgn0031086 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001304690.1 Gene:foxl2b / 100149117 ZFINID:ZDB-GENE-170803-1 Length:285 Species:Danio rerio


Alignment Length:279 Identity:82/279 - (29%)
Similarity:114/279 - (40%) Gaps:76/279 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 KKEESPISKHNSGSSFSSCSSSSSNSSSDSMAAKSNAKPAFTYSALIVMAIWSSSEKRLTLSGIC 85
            |||:.|:.:..|..:..:                  .||.::|.|||.|||..|:|||||||||.
Zfish    23 KKEDEPLQEPGSEKTDPA------------------QKPPYSYVALIAMAIRESTEKRLTLSGIY 69

  Fly    86 KWIADNFPYYRTRKSVWQNSIRHNLSLNPFFVRVPRALDDPGRGHYWALDPYAEDL--------- 141
            ::|...||:|...|..||||||||||||..|::|||......:|:||.|||..||:         
Zfish    70 QYIITKFPFYEKNKKGWQNSIRHNLSLNECFIKVPREGGGERKGNYWTLDPACEDMFEKGNYRRR 134

  Fly   142 --------------SIGET-------TGRL----------RRSNWQQNTGARPKVTGHPYQRMPY 175
                          ..|::       ||.|          ..|:|.......|.:: :...:|| 
Zfish   135 RRMKRPFRPPAAHFQAGKSLFGGDAYTGYLPAPKYLQSGFMNSSWPLPQPPPPAMS-YASCQMP- 197

  Fly   176 YGHGHGNGPYIKAHS--AYFPIMDHQHHAAMVQHYQAMMHRYQMMPHPHHHQHQHQHQHPHS--- 235
                :||...:||.|  :|.|     :..........||:.|..|.|....|||.|...|.:   
Zfish   198 ----NGNMGAMKALSTPSYNP-----YSRMQAMGLPNMMNSYGGMGHHQQPQHQQQSAAPSNSAA 253

  Fly   236 --HFIQQSKPLHIQEPYHH 252
              .|....:|..:...:.|
Zfish   254 ALQFTCSRQPAELYSYWEH 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd19BNP_608369.1 FH 58..135 CDD:238016 43/76 (57%)
foxl2bNP_001304690.1 FH 42..130 CDD:214627 48/87 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.